KEGG   Hydra vulgaris: 100197858Help
Entry
100197858         CDS       T01080                                 

Definition
(RefSeq) beta-galactosidase-like
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
hmg  Hydra vulgaris
Pathway
hmg00052  Galactose metabolism
hmg00511  Other glycan degradation
hmg00531  Glycosaminoglycan degradation
hmg00600  Sphingolipid metabolism
hmg00604  Glycosphingolipid biosynthesis - ganglio series
hmg01100  Metabolic pathways
hmg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100197858
  Lipid metabolism
   00600 Sphingolipid metabolism
    100197858
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100197858
   00604 Glycosphingolipid biosynthesis - ganglio series
    100197858
   00511 Other glycan degradation
    100197858
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100197858
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100197858
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100197858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 100197858
NCBI-ProteinID: XP_012562971
Position
Un
AA seq 614 aa AA seqDB search
MIFNVFICLLIVFAKISSSERTFKIDYENNKFLKDGTEFRYISGSIHYMRVPEDYWEDRL
SKIRKAGLNAIQTYIPWNFHEPTEGNFQFGGQQNVFKFLKLAQKYDLLVILRPGPYICAE
WEFGGFPYWLLKKVGNKTMQLRTSDNLYLQKVENYMSVLLSGLRPYLYENGGPIITVQVE
NEYGSYGCDHEYMYKLESIFRKYLGENVILFTTDGAGDSYLKCGTIKPLFATVDFGPTAE
PKLYFDIQRKYQPLGPLVNSEFYTGWLDHWGGQHAHTSLEDVTDTLDKMLSLNASVNMYM
FEGGTNFGFMNGANQDSNSLQPQPTSYDYDAPLSEAGDPTEKYFAIQHVVSKYLPIPPGP
QPKPTEKTAYGKLYAYKVVSIFDALDEMSRERRYESTSLSFEDLDVAYGYVLYNALVLCH
QNANLLQLTKFHDRSYIIVDKVLQGVLDRNSNNSILLNCSVNQIELSIMVENQGRVNYGP
FMTDTNKGILGDVLWNGERIDVEVKHVLDNDVFKNVRNVAVISSQVASPAFYFFNLSILI
EPTDTFLKLDIWRKGVSVVNAFNVGRYWWIGPQKTLYIPRHVLQKDNIIVLFETETIFPI
TDAYIEFVSSPIIG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgatatttaatgtgtttatttgtctgcttattgtgtttgctaaaatttcatcttctgaa
agaacctttaaaattgattatgaaaacaataaatttttgaaagatggcactgaattccgc
tacattagtggatctattcattacatgcgggttcctgaagattattgggaagatcgtctt
tcaaaaatacgaaaagctggcttgaacgctattcagacgtatattccttggaatttccat
gaaccaactgaaggtaacttccaatttggtggtcagcaaaatgtctttaagttccttaaa
cttgcccaaaaatatgatcttttagttattctgcgacctggtccttatatttgtgctgaa
tgggaattcgggggttttccttactggctgttaaaaaaagtaggaaataaaaccatgcaa
ctaaggacttcagataatttatatcttcagaaagttgaaaattatatgtcggtattgcta
tcaggccttcgaccttatttgtatgagaatggtggcccaataatcactgttcaggttgaa
aatgagtatggtagctatggatgtgatcatgaatacatgtataaactggaatccatcttt
aggaaatatctaggtgaaaatgttattttgtttacaactgatggtgcaggggacagttac
ttaaagtgtggaacaattaagccactttttgccactgttgattttggaccaacagcagaa
ccaaaactttattttgatatccaacgcaagtatcagcctcttggtcctttggtaaattca
gaattttacacaggatggttagatcactggggaggacaacatgcgcacactagtttggag
gatgttactgatacattagataaaatgctttcacttaatgcttctgtaaatatgtacatg
tttgaaggtggtacaaactttggttttatgaatggagcaaaccaagatagcaatagtctt
caaccacagcccacaagttatgactatgatgctcctttatctgaggctggagacccaact
gaaaaatattttgctattcaacatgttgtatcaaaatatttgcctattcctcctggtcca
cagcctaagcccacagagaaaacagcatatggtaaattatatgcctataaggtagtttca
atatttgatgcacttgatgagatgagtagagaaagaaggtatgaaagtacttctttatca
tttgaagatttagacgttgcatatggttatgttctctacaatgctttggttttgtgtcat
caaaatgcaaatttgctgcaattgacgaaatttcacgaccgctcttatatcattgttgac
aaagttttacaaggagttttggatagaaactcaaataatagtattttgttgaactgttca
gtcaaccaaattgagttaagtattatggtagaaaatcaaggacgagtgaactatggtcca
tttatgacagatacaaataagggaattttaggtgacgttttatggaacggtgaacgtatt
gatgtagaagttaaacatgtattagacaacgatgtatttaaaaacgttcgaaatgttgct
gtcattagttctcaagttgctagtccagcattttatttcttcaatttaagtattttgata
gaaccaacagatacttttttaaaactggacatttggagaaagggagtttccgtggtgaat
gcttttaatgttgggcgttactggtggattggtccgcaaaaaactttgtatattccacgt
cacgtccttcagaaagacaatattattgttttatttgaaacggaaaccatttttccaata
actgatgcatatattgagtttgtcagttctcctataattggatag

DBGET integrated database retrieval system