KEGG   Hydra vulgaris: 100197916Help
Entry
100197916         CDS       T01080                                 

Definition
uncharacterized LOC100197916
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1176 aa AA seqDB search
MKIFTLDEYCEGRRKEEGGRRAYKNGPMVLTCIHKIPRKCLTTHPGTRKYGTKSNYTNST
LQEALAKIKLEKMSIGRPIALSIDEELCFENHLLYLSEKGIPIGINDFKSIVKIYLDDIG
KNIQQFKDNRPEKELNGVTPDNIYNMDETGFHDDPGKKKLIFRRSSRHPELIRNTTKTCY
TVVFCGNASGILIPPFFIVKGKHSCAHISLKALNTCEKYNITFLCLVPNSTHLLQPLDVG
YFSCLKADWRSVLNQWGKTFRGKKVNNLPKNLFTQLIKSTLNVGKENLEHNLQAGFKATG
IYPFLPEHVLSKLPSFTNIDIQLNIGESFRNYVDDIHLNYEVSKKFKLPITAGKSVSATE
VEAYYKERDNKKKSQDNIRAKKRGRPLGSNNMVMKINQKLNILQSSSIVNVNQVIEDNEQ
VLPVSQNDAVSSLEQINNHYVHVFLDHDYFVKELVAINMKCHQCHTYSNFLHACLHCVYF
GCYSGCRHIIEHLEKKNHILAIDLNYGNIYCNSCKTYVYDKEFDAVAIEESDRAWQIKYS
GKRKYVEWEPNGIEQELLRINKKRKILTYGSYIGLRGLINLGSTCFMNCILQAFTHTPML
RNYFLSDCHCCPPEDSLNCLVCEMSDLFQEFYSGKKAAHIPFRLLYKVWTNARHLAGYEQ
QDAHEFFISTLDVLHRHFRDDSSTPSNNHNNCNCVIDQIFTGGLQSELTCLACRGVSTTV
DPFWDISLDLGDYNPALKSGRRTPNILFDTTDAKIESFSSRCSEDEKFVPQSLTECLRRF
TRKEKLGSEAKIRCSHCLSYQESTKQLSMKKLPIVVCFHFKRFEHFTKSKKISTHIPFPE
ELDMTPFMSSSNKPRRILTTLIQDAGIPVSPMTVRRRLKEQGFRCCRPAKKPKLTLAKQQ
KRLAWAKSHRHLSVDNWKNVCFSDESTIQILMNKSQFVRRRAGEKFHKDCILERVKHPLS
IMVWSVISGHGTGRLYIVEGTMRQDQYIKVLDTILVPQLKEWFPKNQKFTFMHDSAPCHK
AKKFTEYLKAKKIPVLPWPGNSPDLNPIENLWEIIKREIASEMITNKIQLIEKMIKVWHN
NIDIQNNAIKCIESMPRRVEAVRRQRLYLDVKIYSLFAVVNHQGTLEVGHYTNFIRQKKG
EWFKCDDGWITKSSLSEVLNSEGYLLFYHKEILDYE
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atgaagatttttactcttgatgagtactgtgaaggaaggaggaaggaggaaggaggaagg
agggcatacaagaatggacctatggttttgacgtgcattcataaaataccaagaaaatgt
ttgacaactcatcctggcacaagaaaatatggcactaaatctaattacaccaattctaca
cttcaagaggctttagccaaaattaaattagaaaaaatgtcgattgggcgccctattgcc
cttagcattgatgaggaactttgttttgaaaatcacttactttatttaagtgaaaaaggt
ataccaattggaattaacgattttaaaagtattgtcaaaatctatctggatgatattgga
aaaaatatacaacagtttaaagataaccgaccagagaaggaattaaatggagtaacgcca
gataacatttacaatatggatgaaacagggtttcatgatgaccctggaaaaaaaaaactt
atttttcgtcgatcctctcgccatccagaacttataagaaacacaacaaaaacttgttac
actgttgttttttgtggaaatgcctcaggaatactaattccaccatttttcattgttaaa
ggaaaacacagttgtgctcatatatctttaaaagccttaaatacatgtgaaaagtataat
ataacatttctatgtttggtacccaattccacacaccttttacaacctttagatgttgga
tatttctcgtgtttaaaagctgattggaggtcagttcttaatcaatggggtaaaacattc
agaggaaaaaaggttaataacctgccaaaaaatttatttacgcagctcattaaatctact
cttaatgttggtaaagaaaatctagaacataatctccaagcaggatttaaggcaactggc
atatatccatttctaccagaacatgttctctccaaattacccagttttacaaatatagat
attcaactcaatattggagaatcgtttaggaattatgttgatgatattcatcttaattat
gaagtaagcaaaaaatttaagttaccaataacagcagggaaaagtgtatcagccactgag
gtagaagcatactataaggaaagagacaataaaaaaaaaagtcaagataatattcgagca
aagaaaagaggaagaccacttggatcaaataatatggttatgaaaataaaccaaaaactt
aatattttacaaagttcaagcatcgtaaatgttaatcaagttattgaagacaatgaacaa
gttttacctgtatctcaaaatgatgcagtttcttcattggagcaaataaacaatcactat
gtacatgttttccttgatcatgattattttgtaaaagagttagttgcaatcaacatgaag
tgtcaccagtgtcatacctattctaattttttacatgcttgtttgcattgcgtttacttt
ggttgctactctggttgtagacatattattgaacatttagagaaaaaaaaccatattctt
gcaattgatttaaattatgggaacatatactgtaacagttgtaaaacatatgtttatgat
aaagaatttgatgctgttgcaatagaagaaagtgatagagcatggcagattaaatatagt
ggtaaacgtaaatatgtggaatgggaaccaaatggaattgaacaggagttgttgcgaatt
aataaaaaacgaaaaatattaacttatggatcatacatagggctgcgtggtctaatcaac
cttggaagcacatgttttatgaactgcattttacaagcttttacccatactccaatgctt
cgaaattattttttatcagattgtcactgttgccctccagaagactcattaaactgctta
gtttgtgaaatgtcagatttgtttcaagaattttattctggtaaaaaagcagcacatata
ccttttcgtttgctgtacaaagtgtggacaaatgccagacatttagcaggatatgaacaa
caagatgcacatgagttttttatttcaacacttgatgttctgcatcgtcactttcgagac
gatagctctaccccttctaacaatcataataattgtaactgtgttattgatcagatattt
actggtggacttcagtcagaactcacttgtcttgcttgcagaggtgtttctacaactgtt
gatccattctgggacatatctcttgaccttggtgattataacccagctttaaagtcagga
cgaagaactcctaatattcttttcgacacaacagatgccaaaattgagtcgttttcctct
cgctgttctgaagatgaaaagtttgttccacagtcacttacagaatgcttaaggaggttt
actcgaaaagaaaaacttggcagtgaggcaaaaattcgatgcagtcattgcctaagttac
caagagtcaacaaagcagctatccatgaaaaagttacctattgtagtttgttttcatttt
aagcgattcgaacacttcacaaaatcaaaaaaaatatcaactcatataccttttccagaa
gagttggatatgactccatttatgtcttcatcgaataagcctaggcgaatactaaccact
ttaatacaagatgctggaataccagtatctccaatgacagttcgtcgccgactcaaagaa
caaggatttcgatgctgtcgacctgctaaaaagcctaagctcactctagcaaagcaacaa
aaacgccttgcttgggctaaaagtcatcggcatttgagcgtcgataactggaaaaatgta
tgtttctcggatgaatcgacaatccagatattgatgaacaaatcacagtttgtgcgtaga
cgagctggagaaaaattccacaaagactgcatcttagaacgtgtaaagcatcctctaagt
ataatggtatggtctgtcattagtggacatggaacagggcgcttatatatcgttgaggga
actatgcgccaggaccaatacataaaagttcttgacacaatattggtaccacagttgaag
gaatggttcccaaagaaccaaaaatttacatttatgcatgattctgccccatgccataaa
gcaaagaagtttacagagtacctaaaagcaaagaaaattccagtgctaccatggcctgga
aactcaccagatttaaaccctattgaaaatctgtgggagatcataaaaagggaaattgct
tctgaaatgatcaccaacaaaatacaattaattgaaaagatgatcaaagtctggcacaat
aacatagatattcaaaataatgcaataaaatgcatagaaagtatgccaagacgtgtagaa
gcggttagaagacaaagattatatttagatgtaaagatatattcactatttgccgtagtt
aatcatcaaggaactttagaagttggccactacactaactttattagacaaaaaaaagga
gagtggttcaaatgtgatgatggttggattactaaatcttcccttagtgaagttttaaac
agtgaagggtaccttctcttttatcacaaagaaattctcgattacgaataa

DBGET integrated database retrieval system