KEGG   Hydra vulgaris: 100197951Help
Entry
100197951         CDS       T01080                                 

Definition
(RefSeq) sphingosine kinase 2-like
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
hmg  Hydra vulgaris
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100197951
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100197951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MDDILLEEEFQLHLKCNSIYSVQLMRQNINFYKKDSKQSLKEFRSILLKNVIGCNVFESC
DNKNPIPCLKITSLVKNKKRVRTKQSVVFCFGDNNKGDKKIFDVWVRTILWLLEDPSIDS
EHLKAKTECPLKKKYLIVINPKSGQGKSEKIFIQQVEPILKDAHVVYETLITEYAGHCRN
FASTFDYTKFDAIVICSGDGLLHEYFNGLFERCDWNEVLKVPVSILPTGSGNALAATLMY
SAKEAFEVSSSVFILLKGKSHPLDLFLIQTEKEKRYGFLSVTWGMASDIDIESEKYRFMG
GTRFTVGFIERVCSLRQYSGKFEYLEFDENICEQGVIATESDTETCDIERSVMNETNDIT
CINKSGSYGPSSSLSPLNSQVPGNWKTIEGEFIMLNINLTSHLGLNLHSSPGSLINDGRM
CAQFVMSGISKRNIVKMFIKIEDGNHLSMPELQTKNITAFRITPSPDRIGHIAVDGEEVN
YGVIQGEIFPSLGNVISIHY
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggatgatatattactggaagaagaattccaattacatttaaaatgcaatagcatatac
tctgttcagttaatgcggcaaaacattaatttttacaaaaaagactctaagcagtcttta
aaagaatttagatcaattttgttaaaaaatgttattggctgtaatgtttttgaaagttgt
gataataaaaatccaatcccttgtctaaaaattacttcattggtaaaaaacaagaaaaga
gtgcgtacaaagcaaagtgtagttttttgttttggcgataataataagggtgacaagaaa
atatttgatgtatgggtgcgcacaatactttggttacttgaggatcctagcatagatagt
gaacatttgaaggcaaaaacagaatgtccattaaaaaaaaaatatctaattgtcattaac
cccaaaagtgggcaaggtaaaagtgaaaaaatattcattcaacaagttgaaccaattctc
aaagatgcacatgttgtatatgaaacattgattacagaatatgcaggtcattgcagaaat
tttgcttccacatttgactatacaaagtttgatgcaatagtcatttgttcaggtgatgga
ttgctacatgagtactttaatggattgtttgaaagatgtgattggaatgaagtactaaaa
gttcctgtctctattttgccaactggttcaggaaatgctctggcagcaactcttatgtat
tctgctaaagaagcttttgaagtctcaagttcagtttttatattactcaaaggaaagtct
caccctttggatttatttttaatacaaacagaaaaagagaagcgatacggatttcttagt
gttacttggggaatggcatcagacatagatatcgaatctgaaaaatacaggtttatgggt
ggtacaagatttactgttggatttatagagagagtttgttcattgagacaatatagcgga
aaatttgaatatttagaatttgatgaaaatatttgtgagcaaggcgtcatagctactgaa
tcggacactgaaacatgtgatattgaaagaagtgttatgaatgagacaaatgatataaca
tgcataaacaaatctggttcttacggtccttcaagttccctttcacctctgaattcacaa
gttcctggtaactggaaaacaattgaaggcgaatttattatgctaaatattaatttaacc
tcgcatttagggttaaatcttcatagttctcctgggtcattaattaatgatggtcgcatg
tgtgctcaatttgttatgagtgggataagtaaacgtaatattgtaaaaatgtttattaaa
atagaagatggaaaccatcttagtatgccagaacttcaaacaaaaaatataacagcattt
cgaataacgccatctcctgacagaattggtcatattgcagtagacggagaagaagtaaat
tatggagtaatccaaggagagatttttccttctcttggaaatgttatttcaattcattac
taa

DBGET integrated database retrieval system