KEGG   Hydra vulgaris: 100198247Help
Entry
100198247         CDS       T01080                                 

Definition
(RefSeq) probable protein disulfide-isomerase A6
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
hmg  Hydra vulgaris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100198247
Enzymes [BR:hmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100198247
Chaperones and folding catalysts [BR:hmg03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100198247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 243 aa AA seqDB search
MFSLVCLIVVIFTFSNTLAEYTLTLTKENFDSHVLDSRKNVLVEFYAPWCGHCKNLAPTY
EKVAETFKNEPNCVVAKVDADSEKELGSRFGISGFPTIKFFSKTNKAGEEYSSGRSEQDF
IDFLNQKCGTNRVSGGGVDDQAGRINAYDDIAKKFISSTGDRNSLIAEIETANADEADSE
HKQSGDYYVKVMKTILEKGDDYPKNEIARLTRVLGGNMSAAKMDLMHKRKNILSQFVREK
EEL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgttctctttagtttgcttaattgtagtcatatttactttttctaatacattagcggaa
tatacattaactcttactaaagagaattttgattctcatgtcttggattcacgtaaaaat
gtcttggtagagttttatgcaccatggtgtggccactgcaaaaatttagcaccaacatat
gaaaaagtagctgaaacatttaaaaatgaacctaattgtgtagttgctaaagttgatgct
gatagtgagaaagaattgggttcacgatttggtatttctgggtttccaactatcaaattt
ttttccaaaacaaataaagctggagaagagtactcaagtggtcgtagtgagcaagatttt
attgactttttaaatcagaaatgcggaactaatcgtgttagtggtggtggagtagatgac
caggcaggaagaattaatgcatatgatgatatagctaaaaaattcataagctcaacaggc
gatcgcaattctttaattgctgaaattgaaacagcaaatgctgatgaggctgactctgag
cacaagcaatctggagattattatgttaaggtcatgaaaactatattagaaaaaggagat
gactatccaaagaatgaaattgctagactaactagagttctcggaggaaatatgagtgct
gccaaaatggatttaatgcataaacgaaaaaatattttaagtcaattcgttcgagaaaaa
gaagagttgtaa

DBGET integrated database retrieval system