KEGG   Hydra vulgaris: 100198292Help
Entry
100198292         CDS       T01080                                 

Gene name
prkaca
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
hmg  Hydra vulgaris
Pathway
hmg04140  Autophagy - animal
hmg04310  Wnt signaling pathway
Module
hmg_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100198292 (prkaca)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100198292 (prkaca)
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100198292 (prkaca)
Protein kinases [BR:hmg01001]
 Serine/threonine kinases: AGC group
  PKA family
   100198292 (prkaca)
Messenger RNA biogenesis [BR:hmg03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100198292 (prkaca)
Chromosome and associated proteins [BR:hmg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100198292 (prkaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase POR
Motif
Other DBs
NCBI-GeneID: 100198292
NCBI-ProteinID: XP_002163934
UniProt: T2MGS3
Position
Un
AA seq 351 aa AA seqDB search
MGNAATAKKGDSENAVKAFLSQAQEDFKKKWDSPSHNTAGLDEFERIKTLGTGSFGRVML
VKQRENGKYYAMKILDKQKVVKLKQVEHTLNEKRILQAIEFPFLVKLEWHFKDNSNLYMV
LEFVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDDKGY
LKVTDFGFGKRVKGRTWTLCGTPEYLAPEIILSKGYNRAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKMRCPSHFSQDLKDLLKSLLQVDLTKRFGNLKNGVADIKNHRWFSS
TDWIAIYQKKVDAPFIPRCKGPGDPSNFDDYEEEALRISSTEKCAKEFADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgcagcaactgcaaagaaaggagattcggaaaatgctgtgaaagcatttctg
agtcaagctcaagaagattttaaaaaaaaatgggatagtccttcacataacacagctggc
cttgatgagtttgaaagaataaagacacttggtactggatcttttggaagagtaatgctg
gttaaacaaagagaaaatggaaaatattatgcaatgaaaatattagataagcaaaaagtt
gtaaaattaaaacaagttgaacatacattaaatgaaaagcgtattctgcaagctatagaa
tttccatttttagtaaaacttgagtggcatttcaaggataattcaaatttgtatatggtt
ttggaatttgttcctggtggtgaaatgttttctcatttgaggcgtattggtagatttagt
gaacctcattctcgattttatgcagcacaaattgtcttagcatttgaatatctacattct
cttgatcttatttatagagatttgaaaccagaaaatttactgatcgacgataaaggatat
ttaaaggttactgattttggatttggtaaacgagttaaaggaagaacatggactctttgt
ggaactccagagtatcttgctcctgaaattattctaagcaagggttataatagagcagta
gattggtgggctcttggtgttcttatctatgaaatggctgctggttatcctcctttcttt
gctgaccaacctattcaaatttatgaaaaaatcgtttctggaaagatgcgatgtccctct
cacttcagtcaggatcttaaagatcttttaaaaagtttactgcaagttgatcttacaaag
cgctttggtaacttaaaaaatggtgtagcggatataaaaaaccaccgttggttttcttca
acggattggattgcaatttatcagaaaaaagtggatgctccatttattcctcgttgtaaa
ggtcctggtgatccttcgaatttcgatgattatgaggaagaagctctgcggatctccagt
actgaaaaatgtgctaaagaatttgcagatttttaa

DBGET integrated database retrieval system