KEGG   Hydra vulgaris: 100198292Help
Entry
100198292         CDS       T01080                                 

Gene name
prkaca
Definition
protein kinase, cAMP-dependent, catalytic, alpha
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
hmg  Hydra vulgaris
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100198292 (prkaca)
   04340 Hedgehog signaling pathway
    100198292 (prkaca)
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100198292 (prkaca)
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100198292 (prkaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 351 aa AA seqDB search
MGNAATAKKGDSENAVKAFLSQAQEDFKKKWDSPSHNTAGLDEFERIKTLGTGSFGRVML
VKQRENGKYYAMKILDKQKVVKLKQVEHTLNEKRILQAIEFPFLVKLEWHFKDNSNLYMV
LEFVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDDKGY
LKVTDFGFGKRVKGRTWTLCGTPEYLAPEIILSKGYNRAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKMRCPSHFSQDLKDLLKSLLQVDLTKRFGNLKNGVADIKNHRWFSS
TDWIAIYQKKVDAPFIPRCKGPGDPSNFDDYEEEALRISSTEKCAKEFADF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgcagcaactgcaaagaaaggagattcggaaaatgctgtgaaagcatttctg
agtcaagctcaagaagattttaaaaaaaaatgggatagtccttcacataacacagctggc
cttgatgagtttgaaagaataaagacacttggtactggatcttttggaagagtaatgctg
gttaaacaaagagaaaatggaaaatattatgcaatgaaaatattagataagcaaaaagtt
gtaaaattaaaacaagttgaacatacattaaatgaaaagcgtattctgcaagctatagaa
tttccatttttagtaaaacttgagtggcatttcaaggataattcaaatttgtatatggtt
ttggaatttgttcctggtggtgaaatgttttctcatttgaggcgtattggtagatttagt
gaacctcattctcgattttatgcagcacaaattgtcttagcatttgaatatctacattct
cttgatcttatttatagagatttgaaaccagaaaatttactgatcgacgataaaggatat
ttaaaggttactgattttggatttggtaaacgagttaaaggaagaacatggactctttgt
ggaactccagagtatcttgctcctgaaattattctaagcaagggttataatagagcagta
gattggtgggctcttggtgttcttatctatgaaatggctgctggttatcctcctttcttt
gctgaccaacctattcaaatttatgaaaaaatcgtttctggaaagatgcgatgtccctct
cacttcagtcaggatcttaaagatcttttaaaaagtttactgcaagttgatcttacaaag
cgctttggtaacttaaaaaatggtgtagcggatataaaaaaccaccgttggttttcttca
acggattggattgcaatttatcagaaaaaagtggatgctccatttattcctcgttgtaaa
ggtcctggtgatccttcgaatttcgatgattatgaggaagaagctctgcggatctccagt
actgaaaaatgtgctaaagaatttgcagatttttaa

DBGET integrated database retrieval system