KEGG   Hydra vulgaris: 100198416Help
Entry
100198416         CDS       T01080                                 

Definition
serine/threonine-protein phosphatase PP1-beta-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
hmg  Hydra vulgaris
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hmg03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 299 aa AA seqDB search
MTEVEKFNVDNVIAQLLEGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI
CLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAI
LDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKEVTGWGENDRGVS
YTFGPDVVAKFLHKHDFDLICRAHQVVEDGYEFYAKRQLVTLFSAPNYCGEFDNAGSMMS
VDETLMCSFQILKPADKKKFPYGGFGAGRPITPPRGGAATAAATGAGNTPKGKTKKVDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagttgaaaaatttaatgtcgataatgttatagcacaacttttagaaggtgac
atacatggccagtattatgacttgctgcgattatttgaatatggtggttttcctcctgaa
tcaaattatctttttctcggtgattatgttgatagaggaaaacaatcacttgaaacaata
tgtttgttattagcttacaaaataaagtaccctgaaaatttttttctgttgcgtggcaac
catgaatgtgccagtatcaatagaatatatggattttatgatgaatgtaaaagaagatac
aatattaagttatggaaaacatttactgattgctttaattgcttacctgttgctgcaata
ttggatgaaaaaatattttgttgtcatggtggtttatcccctgacctccaatcaatggaa
cagattcgaagaattatgcgaccaactgatgttccagaccaaggattattatgtgatctt
ttatggtctgatcccgataaggaagtaactggttggggtgagaatgacagaggagtatca
tatacatttggaccagatgttgttgctaagtttcttcataagcatgattttgacttgatt
tgtcgtgctcatcaagtagttgaagatggttatgagttttatgcaaagagacaattagta
actttattttctgctccaaattattgtggagagtttgacaacgcaggttcaatgatgagt
gttgatgagactcttatgtgttcatttcagattttaaaacccgctgataaaaagaaattt
ccatatggtggttttggtgctggccgtccgataactccaccgcggggtggcgctgcaact
gccgctgctactggagcaggaaacacgcctaaaggaaaaacaaaaaaagttgataaataa

DBGET integrated database retrieval system