KEGG   Hydra vulgaris: 100198602Help
Entry
100198602         CDS       T01080                                 

Definition
inactive phospholipase C-like protein 2-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
hmg  Hydra vulgaris
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100198602
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100198602
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100198602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 843 aa AA seqDB search
MALCKRSITQSGVGNTFARNHTFDIASTLQGGKAMTQEYELTGSFEVVEYSENIDVPSAD
GLDSVEDECVFDVERQDAADVDFDPDIDGKEPKVFTQGEPNDLGLSTECPKIKILNISRT
RRAGRKLKSELKSAQKTGLDKLFRFMVYSKKILKHLCNGCEVRQSNLSKKSTNIVCLMKK
KYLFLDEDKTVLRFKPSVLRSNFKILVSNINDINVAESIETKLCFKKKLLHQFIISYKDE
ENNAHQIGFIVEDQNQLKLWTSGLQYLSDKFKKPEDPIVDDWLREAYFAADINKNNLLGL
KEINQMFNSLNIFKENSDIKLKFQECCSDGKNNENAQLTRTEFAKFFKFFSFDSNEVSSI
IKDYGRTIYGKICLNAESLQKFLSEVQQQKLSLSECKKLITKYDENKGSFLSAEGIYEFT
YYLLSDQLVGMSSTKAYDKALKKGCKTLELDCYDGENNEPIVYHGFTLTSKVLFKDIIDT
IAFGAFLQSDYPVILSFENHCSPEQQIVMAQHLKEKLGNMLFVEDPDVNQSKLPSPEALK
RKIFIKAKKRSQNAEIDDDAVDASIKKRQSKIKQKINVAEEFSNIINYVESITFKSLEQG
LASQKYFQNVSLGEKKLLQLGKDYPMKLIEYSNKFLVRTYPRGSRIDSSNYNPTKGWVFG
CQIVALNFQTPGELMDINDGLFALNGKCGYVLKPECLRSGKFDPQNVENFSKTVCKVNIK
IISGHLLPKASKDGTIPDPFIRVNIHGIPKDEVLGKFATKKIKRNGFNPQWNEDFQFDLY
APELAHIRFAISDSDMGADDYICQYSIPFSAIRTGYRRVPLLNRSGHTIRNASLLVFIQK
NIK
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggctctatgcaaacgctctattacccaatcaggagtgggcaacacgtttgctagaaac
cacacttttgacattgctagtacgttacaaggtggtaaagctatgactcaagaatacgaa
ctaacaggaagttttgaagtcgttgaatattctgaaaacattgatgtaccatcagctgat
ggattagactctgttgaagacgaatgtgtttttgatgttgaacgtcaagatgcggctgat
gttgactttgatccagatattgacggcaaagagcccaaagttttcacacaaggtgaaccg
aatgatttgggattaagtacagaatgtcctaaaattaaaattctaaatatctcaagaact
agacgtgctggaagaaaattgaaatcagaattgaaatcagcgcaaaaaactggtttagac
aagttatttagattcatggtgtattcaaaaaaaatattgaaacatttatgcaatggatgt
gaagttagacaatcaaatttgtcaaaaaaaagtactaatattgtgtgcttgatgaagaaa
aaatatctttttcttgatgaagacaaaactgttttaagatttaaaccatcagttctacgg
agtaatttcaaaatcttggtttcaaacattaatgatataaatgttgcggaatctattgaa
acaaaactctgttttaagaagaaacttcttcatcagtttattatttcatataaagatgaa
gaaaataatgcacatcaaataggttttattgtagaagaccaaaaccaattgaaactttgg
acttcaggtcttcaatatttatcagataagtttaaaaaaccagaagatccaattgttgat
gattggttacgtgaggcatattttgctgctgatatcaacaagaataatttgcttggttta
aaagaaatcaatcagatgtttaattccttaaacatatttaaagaaaactctgatattaag
ctcaaatttcaagaatgctgcagtgatggtaaaaataatgagaatgcacagttgacacga
actgagtttgcaaagttttttaagttcttttcatttgatagtaatgaagtttcgagcata
ataaaggattatggaagaacaatatatggcaaaatttgcctgaatgcagaatctctacaa
aaatttttgtcagaagtacaacagcaaaagttaagtttaagtgaatgcaagaagttaatt
acaaaatatgatgaaaataaaggttctttcctttcagctgaaggtatttatgagtttaca
tactatctgttaagtgatcaacttgttggtatgtccagcactaaagcatatgacaaagct
ttaaaaaaagggtgtaaaactttggagttggattgttatgatggtgaaaacaatgaacca
attgtataccatggttttactttaacatctaaagtacttttcaaggatataattgatact
attgcatttggtgcatttttacagtcagattatccagtaattttgtcttttgaaaatcat
tgttcacctgagcaacaaattgtcatggcacaacatttaaaagaaaaactaggaaacatg
ctgtttgttgaagatcctgatgtaaatcaatcaaagctcccctctccagaagcattaaaa
agaaaaattttcataaaggcaaagaaacgaagtcaaaatgcagaaattgatgatgatgca
gttgatgcaagcatcaagaaacgtcaatccaaaataaagcagaaaattaatgtagctgaa
gaattctccaacattataaactatgttgagtctattacttttaagtcgttggagcagggc
cttgcttctcaaaagtattttcaaaatgtatcacttggtgagaaaaaattattgcaactt
ggtaaagattatccaatgaaacttattgaatatagcaataaatttttggtaaggacatat
cctagaggttcaagaattgactccagcaactacaatccaactaaaggatgggtgtttggt
tgccaaattgttgcattgaattttcaaaccccaggggaattgatggatattaatgatggc
ttgtttgctttgaatgggaaatgcggatatgtcctcaaacctgagtgtttaagaagtggc
aagtttgatcctcaaaatgttgaaaatttcagtaaaactgtttgtaaagtcaacatcaag
attataagtggacatctgcttccaaaagcttcaaaagatggaactataccagatcctttt
atcagagtaaacatacatggtatccctaaggatgaagttcttggaaagtttgcaacaaaa
aaaatcaaaagaaatggtttcaatccccagtggaatgaggattttcaatttgatttgtat
gcacctgaattagcacacataagatttgccattagtgatagtgacatgggtgcggatgat
tatatctgccagtactccatacctttttctgccataagaacaggttatcgacgggtgcca
ctactcaatcgttcaggtcacacaattcgaaatgcttctcttttggtctttatccaaaaa
aatattaaatag

DBGET integrated database retrieval system