KEGG   Hydra vulgaris: 100198684Help
Entry
100198684         CDS       T01080                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hmg  Hydra vulgaris
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100198684
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100198684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MDIVVVGSCNADLFSYVERFPKVGETLCGKKFVIGCGGKGANQCVMSAKLGAKTAMIGCV
GDDVFGEMFLKAFSTAGVDITNLKTVLSATTGVATITVNEKGENSIVITKGANNCISTDQ
VEASIDTIVKAKVALFQLEVDLATTLYALKIAYENGVTTIFNPAPALKELPNEFLMYSSI
LCCNETEAEILTGLSINLDFPVTDCENAVRNLLSKGPLKVVLTMGSYGAIFGEKGSDAVH
HILTPPSIVDKVVDTTGAGDCFVGSLAYFLAQRKDLSFNEVVRRSVAIASISVTKHGTQT
SYPSLNDLPEDLIQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatagttgttgttggatcctgtaatgcggatctttttagttatgttgagcgtttt
ccaaaagtgggtgaaacattgtgtggaaaaaagtttgtgataggttgtggaggaaaagga
gctaatcaatgtgttatgtctgctaaacttggtgcaaaaactgcaatgattggttgtgtt
ggagatgatgtgtttggagaaatgtttttaaaagcatttagcacagctggtgttgatata
acaaatttgaaaacagttttatctgccaccacaggtgttgctactattactgttaacgaa
aaaggtgagaatagcattgtgataaccaaaggagcaaacaattgtatttcaaccgatcaa
gttgaagcttctatagataccatagtaaaagccaaagtggctctttttcaacttgaagtt
gatttggcaacaacactctatgctttaaagattgcatatgaaaacggagttacaactatt
tttaatcctgctcctgcattgaaagagttaccaaatgagttcttgatgtattcatctata
ttatgttgtaatgaaactgaggcagaaatattgacaggtttatcgattaatttggacttt
cctgtaacagattgcgaaaatgcagttcgtaatttacttagcaaaggccccttgaaagtg
gtgttgacaatgggttcatatggagctatttttggtgaaaaaggatcagatgctgttcat
catatactgacaccaccttctatagttgataaagtagttgatactacgggagctggtgat
tgttttgttggatcccttgcatattttttagcccagcggaaggatcttagttttaatgaa
gttgttcgtagatctgtcgcgatagcgtcgatatcggtgactaaacatggtactcaaaca
agttatccaagtttgaatgatttacctgaagacctgatacaataa

DBGET integrated database retrieval system