KEGG   Hydra vulgaris: 100198763Help
Entry
100198763         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 35-like
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100198763
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100198763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 889 aa AA seqDB search
MCEIMDKILLGILNSPYPDKLKIELIQKISYSAEKNIDNKPIDNILQICVDFFKEDNYSN
ELNSAMDNMFMNWVKHNKDASLRFLTDEVLKKPLNQMESNIKIKHVRSINKCINTINAIH
DISTSPIKTVLSTYLYSFFFKVDELELLACFCGLYLQYPVLFPSNLNFSVLSDLSTRMVS
IISSSQFVFITSKDYPTYYNHLNHIYEFFLKHFGQDEVLKKQIAITIFNTLTNPNKCPSI
SLAKLVPCFQLEVLSKDLEVIILSSNISDETLIFMLSQMVDWACFPTDDFYIERLINNFI
GLLIRFQKSNVLFVVIENKINQLCNLILFPSTRKTSLGVLTFSLMSYLHSPTPFHQACKF
FPKLIDHLQKEESCKKYDKILAELIFTLMYHFPGYPDVYSDILVALKNYKKPSESEMKLW
LSASSVLVKVEVPHCSIVSRKSETGKVGLENLGNTCFMNSIIQALFNLINFRNDIISHVF
SPSTQNVSVELQKIFSLLSFSERPAIVPKSFYDASRPEWFCVGSQQDCSEYFKYVLDRLE
KDKPSLVQHFTGMLNVIVECLNCHVQSIRKELFNDLPLSFHENVAGQYTLKGGNPTGNQS
RSMQCDRGESSIILEQVENDDTLSDKEVSDDESLLSMLCAYFLPEHLSEMNSYFCNNCQS
LQDATKRINIVSFPPYLTLTLKRFMFNVKTQKRSKLLQQIDYPLTFKLCKGCSACCDNTK
ISSQNPSIIANSLENCQSEIKYRLSSVIVHSGLSLDCGHYYSYTCQYSANGYTWLLMNDS
RISKVSMENFSKSGKSFPRDTPYICIYEKYDIDLFATAKDVLLPQYLRDMVDQDNAIYRE
EIRMEELKQKRVFPKNTFNKDKDDDDDDFNCSTSCSSSSSNWDSGKYIF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaaattatggataaaatactgttaggaatattaaactcgccatatcctgataag
ctaaagattgaattaatacaaaaaataagttatagtgctgaaaaaaatatagataacaaa
cctatagataacatacttcaaatatgtgtcgactttttcaaagaagacaattattctaat
gaattgaattcagcaatggacaacatgtttatgaattgggtaaagcataataaagatgca
tcgctaagatttcttactgatgaggtactaaagaagcctttaaatcaaatggaatctaac
ataaaaataaaacatgtaagaagtataaataaatgtattaatactataaatgctattcat
gatatttctacttcacctataaaaacggtgctgagcacttatttatattcattctttttt
aaagtagatgagcttgagcttcttgcatgtttttgtggtctatacttgcaatatccagta
ttgtttccgtcaaatttgaatttttcagttctttcggatttgtccaccagaatggtgtcc
attattagttcaagtcagtttgtttttataacaagtaaagactacccaacttattataac
catctcaatcatatatatgaatttttccttaaacactttggccaggatgaagttcttaag
aagcaaatagctataacaatttttaatacattaactaatccaaataaatgtccttcgata
tctcttgcaaaacttgtgccctgttttcaacttgaagtattaagtaaagatctagaagta
attattttgtcttcaaacatctccgatgaaacattgatttttatgcttagtcaaatggtt
gattgggcttgctttccaactgatgatttttatattgaaagattaatcaacaattttata
ggattactaatcagatttcaaaaatcaaatgttttatttgttgttattgaaaacaaaata
aatcagctctgcaatctaattttatttccatcaacgcgtaaaacttcactcggtgtttta
acattttctctgatgtcctaccttcattctccaacaccttttcatcaggcttgcaagttt
ttccctaaactcatagatcatttacagaaagaagagagctgcaaaaaatatgacaaaatt
ttagcagaattaatcttcaccttgatgtatcatttcccagggtatccagatgtatattct
gacatattagttgcattaaagaattacaaaaaaccctcagaatctgagatgaaattgtgg
ttatctgcttcttctgttcttgttaaagtggaggttcctcattgttcaattgttagcaga
aagtcagagactgggaaagtgggattagaaaatctaggcaatacttgttttatgaacagc
atcattcaagctctttttaaccttatcaattttagaaacgatattatcagccatgtattt
tctccatcaacacagaatgtttctgtagaattacaaaagatattttcattactatctttt
tcagagcgaccggcaatagttccaaaatcattttatgatgcttctcgacctgaatggttt
tgtgttggatctcaacaggattgttccgagtattttaaatatgttcttgatcgcttagag
aaagataaaccttctttagttcaacattttacaggcatgttgaatgtcattgttgaatgc
ttaaactgtcatgtacaatctataagaaaagaattgtttaatgatttaccactttctttt
catgagaatgttgcaggtcaatataccttaaaaggtgggaatcccacaggaaatcaaagt
agatcaatgcaatgcgatagaggagaatcatccataatactggagcaagtagagaatgat
gacaccttatcggacaaagaggtttcagatgatgaatctctcttaagcatgctatgtgca
tattttcttcctgagcatttaagtgagatgaatagttacttttgcaacaattgtcagtct
ctgcaagatgcaacaaaaagaataaatattgtcagctttccgccatacttaactttaact
ttaaaacgatttatgtttaatgtgaaaactcaaaaaagaagcaagttactacagcaaata
gattatcctttgacatttaaattatgcaaaggatgcagtgcttgttgtgataacacaaaa
atatcttcgcaaaatccttccattatagctaattcacttgaaaattgtcagagtgaaata
aagtataggttgtcgtcagttatagttcattctgggctatcacttgattgtggtcattat
tatagttatacatgtcaatattctgcaaatggatacacctggttacttatgaatgatagt
cgaataagcaaagtatcaatggaaaatttttcaaaatctggaaaaagttttcctagagat
acaccttacatttgtatatatgaaaagtatgacatagatttgttcgcaactgctaaggat
gtacttttaccacaatatctaagagatatggtagatcaagataatgcaatatatagagag
gagattcgaatggaagaattaaaacaaaagcgcgtttttcctaaaaatactttcaataaa
gataaagatgacgacgacgatgattttaattgctcaacttcttgttcaagttctagtagc
aactgggattcaggaaaatatatattttag

DBGET integrated database retrieval system