KEGG   Hydra vulgaris: 100198859Help
Entry
100198859         CDS       T01080                                 

Gene name
usp34
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 34
  KO
K11853  
ubiquitin carboxyl-terminal hydrolase 34 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100198859 (usp34)
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100198859 (usp34)
Ubiquitin system [BR:hmg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100198859 (usp34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 3158 aa AA seqDB search
MSSDCCKELKIFLDNVENEPEAQKKNIYELAKAVNSTSRQCTCLIHNPALILPLECILKD
FYQLFVTFINNYSQNCGVENQSSVEQIIQAISKSFQINFPLYPAYESVKNNFEVKVEEKE
AIQVYCDSEENSNISELLYQNVAYFCHLGGVEAVTQLFASEKSLPLCLASSLICIIAQLR
GYLHEEATSKLIKPLSILVTKYLQKMCEDDLRLPSARSMAEMMINSVKVQDSNHPTNDID
LLNISFKYFMSSTLAVRMAGLNLMTNQIHNLIDLSQNQVSPDSIDSLCTEMADWLNQNEM
VEHLFGPNYHVELIKQSQFLLSFLAQERQLHSKHIDCLWAAAQVKHISRYVLELLIMLAK
VMDVISVQYLLHQIAQLSVNSHTKQTLLLSSLLIRSIWTAGLTGANLIINSPIKLTSKNS
FASPPLFKELQVSPIQSPSLSSSVSTDEEISDIHGGRFMESQLRNLEIRVLDQNLRSQVI
TPLLELSPSASEGIDNQLLSRQVSNDLEKCDDTVSSTQTNGSLTDQNQDILDDLDDDVSM
CSVSNTPVKLDNQLNINFKVESLCEPGNTLLWDLIQEPNCNNMSDGLLEEAQKLLWQLIC
YSGNKKVRMVFIEGCLENIKKNQSVMVSFKILPKILSVYPHKTSESSSLLSWAIKDLQLM
NTFFNNLLVFVQILKEVENSATDQKDSIEESIQARLEFLAAIYSNDITPDHFRLSISQVD
CLWNCLVTQLPHNYHFLTLSWLLKQTDNEDLHALGLDAFKHIFVNKLSELNAEKMTLIGL
SLFQKLFGLTRLSNATPFVNKESDTEEYVLGTQQLWNIALKADCLKVSNEAMNVLNHLYL
TVGENSVQKEEEFIQNCMTVLREGVNTIEKNYLQSLKSIQQVLKILKNHLQAYIKRLAFH
LELWSLTGRNVASHQNVKKVSSKDVPLRIVCQPTGVIDKITFKMMSCDLLATLRARITHW
CIGVQERKKPNDNSTELKPPFRLISHGHELTHDLDMKTLSEIGIRDQQLVYISIMNMQKE
GMLNSVQLPYSLQNPPNFESVPMIQLLREKNFFELFNLLDVLYKVSNSESYQKVYCEISN
LPNSSVNDTLEQSFEDSRELVKPLSARSLLNNTWELILMLPTNENLKEKYLKLSFKEDID
WDNILCFEQKFMLLYVLQILDSISLPFVQISNKENTNGDSSGDSDSSVVDKGSSVSNLDY
AWVHKVFQTGLVKHLLRFILKEEINQDEWSTSCFAYIIKLITRIGLVSDVDLGPVTKKTL
RKTHIFRARYRSTETDNIVIIHQFSQELLDLLDENLFQRVINFLYQIFESSNDLFTLSNQ
DVRASVVYHCLSFLVCSVSCNEELRKKLLHHDKFSSLLLRLVFYAPQRSVRTEGAHGIYK
LCLCGSQVGLNKVLNIMLNKLSDLVQLKNMSAEQLASLSSHKITNLNYKDYFWLLCRLIN
KYNKVDGEDEICIRTAITEVSMYIKESKSCIDNGDYCLVGLLQVCTALLQHDTDFKLLPE
GFGLMQNVFSKILFNLPSSISEIQEPHHEAKGSRLAAYELLLQLVSGCKEMYLELLTFFI
KHHRPNEKNKNHCSYGWNYWPYEQERSSVGYVGLINLGATCYMASCVQQLFMIPKARSVI
LNEEITSQTKHSAILKEVQKMFAYLHSSIRKAYNPKLFCRTYTMDKQPLNTCEQKDMTEF
FTDFVSKLEEMGPDLKELMRELFCGVITNNVISLDCLHVSKTEEEFYSVRCTVADMKNLY
ESLDEVTVKDVLEGDNKYTCSQCNDKVRAEKRACFKTLPKVLCFNTMRYTFNMVTMMKEK
VNTHFSFPMKLNMAAYTEDYLLIKNCDGDPDDNPSHWYNLAGVVVHTGTADGGHYYSFIR
DRCSKENNWYLFNDAEVKTFDPMQIAAECFGGEMTTKTFDAMTEKYMDFSFEKTHSAYML
FYEHCEMDKEIQTSHINLPKDLQELISEDNHQFLQDKLVFEPNYFSFLWQFCNNIPKTLS
VSVTFHVTKLAISFLLETLVHSREKPHIKNWVELIVHGFDNSQSACEWFLDSMTQDDWWL
QQMFVKCPAQHLRQMFGHLCLIPIKNLRSSQVYFYTMSTEEGISDEDDIGSCSPITRFIK
AILILLEDIPRGYCKNLAELFHFMYQFLSFGHEECSFLLQIDAITMLVQFYSCLKANEPS
ESIAEEEEELDLEDEDILSMFPEDKFYPNALEKMIGSIALLVEAARDGPELHLSDSDLQC
FTSTKEVPFLCQIIMDGINLRQTANIIFHLSCYNQQMAEMIVHLILSTIQKLSIDQSQNF
FKVLSLLIEVGENGLPGLPSYTAIVLSKIWQTAEYSPALTLDWISNHVSRNKEIHKFVIE
NMEKWVEKYLIIDPNPRIRGGAAYLLVSLVPNIHFPQSFRGRLFSTPQKQIKMSEEAKLI
LKKVYEFLLKMLPSLGKYCDKSHLGTTRLVNYFTLLNYCCISNDEKAMFTPFSIDLWRLY
HPLMSEPDVSIHFNKQALLTFWYHACENFEDNVKFITETRDVAFNIAYNYILSNDDQEVI
SYNNSTLPMYYGLLRLACNYSKQFCKTLSVHPNMTWAFEHLLPRANHYPQVIEELLNLIK
LFCGSKYTSNEDLVLASTFKTKTIELVCSSIEGHNAWMTLVNVLRVLITSKEDCLHVVYS
NGLNPLGEAFCTLHLMYYEATACNITNDILEVTNLLQTVLGYCQSHISDIDPLYKVLHSW
EDRADVMIKALSMLNSFVAKEIQKSCLDLLHELLQTYPEEFIETVAPIIHQSHLAIRMTP
QENFHFGPHFPKPGTQTKVNRKLSSLRPKEPELNMTLHPHIIESFSGDADGAYKIQLCDY
FHGYHFFVDKMCRYGLNAEPISTIIIEISCLLAVEMLPLKFQFFPKLWQEVWSKSSENTK
FRSCIHTLFTCDSFLEFMDALFTEERILFDDSVYYTFACIFFPKVYSKVLPDHQRQNLLN
SIALSMIAEATNIKQMGNVEFERVFPKLHGDLRALSLLMSVTETNELTSTTSLEEYVNSL
LERHNQLSSTIHIRSVSDEKDSYKDEKGSSDTPHLKQQLIDESNKPSDEEPPNKRIKGSE
PLPGPSNSSHTNISNSGSSCSSPDYSDDCDSSSDEKKSSDKTKNKKESDCGDEKPCISTS
FLNKKVVKSAQLKKACLTLLGLLSRGQKKEKTLPAEIT
NT seq 9477 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgattgctgtaaagagctaaagatttttcttgataatgttgaaaatgagcct
gaagcgcaaaaaaagaatatttatgaacttgctaaggctgtaaattctacttcaaggcaa
tgtacctgtttaattcataatcctgctcttattttgcctctggagtgtatattaaaagat
ttctaccaattatttgttacttttattaacaattatagtcaaaactgtggtgttgaaaat
cagagttcagttgaacaaattattcaagcaattagtaaaagttttcaaataaatttcccg
ttatatccagcctatgaaagtgtaaaaaacaattttgaggtaaaggtagaagaaaaagaa
gccattcaagtatattgtgacagtgaagaaaattcaaatatatcggagcttttatatcaa
aatgttgcatatttttgtcatttgggtggtgttgaagctgtgactcagttatttgcttca
gaaaaatcattgccattgtgtttagccagcagtttaatatgcattattgctcagttaaga
ggatatcttcacgaagaagctacttcaaaacttataaagccattatctattttagtaaca
aagtatttacaaaaaatgtgcgaagatgacctacgattacccagtgccagatcaatggca
gaaatgatgataaattcagtgaaagtacaagatagtaatcatccaacaaatgacatagat
ttgcttaatatttcattcaagtatttcatgtctagcacattggctgttcgcatggctgga
cttaatctgatgacaaatcaaatccacaatctaattgatcttagccaaaatcaagtgtct
cctgatagtattgacagtttatgtacagaaatggctgactggttaaaccaaaatgaaatg
gttgaacatttatttggaccaaactatcatgttgaattaataaagcaatcacaattcctg
ttgagttttttggcacaagagaggcaattacattctaaacatatagattgcctttgggct
gctgcacaagtaaagcacattagtcgatatgttctggagcttttgataatgttagcaaaa
gtgatggatgttatttctgtccagtatttactacatcaaattgctcaactttcagttaac
agtcatacaaaacagactctgctactgtcatcattactaatacgaagtatatggacagca
gggttaactggggcaaatcttataatcaacagcccaataaaattaacaagcaaaaattca
tttgcttcaccacctttatttaaagaattgcaagtgagtcctattcaaagtcccagttta
agtagcagtgttagtacagatgaagaaatatcagatatacatggtggaagattcatggaa
tctcagctaagaaatttagaaattcgagttcttgaccagaatctacgttcacaagttata
actcctttgttggagctttctccttctgctagtgaaggcattgataatcagttactaagt
agacaagttagtaatgatcttgaaaaatgtgatgatacagtaagctctacacaaactaat
ggcagtttgactgatcaaaatcaagacattctagatgatttagatgatgatgtatcaatg
tgctctgtaagcaacactcctgtcaaattggataatcagttaaatataaactttaaggtt
gaaagcttatgtgagcctggaaacacactattatgggatctaattcaggaacctaattgt
aataatatgtcagatggtttgttagaagaagcacagaagttgttatggcaattaatttgt
tattccggaaacaaaaaagttaggatggtttttatagaaggttgtttggaaaatataaaa
aaaaatcagtcagttatggtatcatttaagattttgccaaaaatacttagtgtgtatcca
cataaaacttctgagtcatcttcattactttcatgggcaattaaagaccttcaattaatg
aatactttttttaacaatttattggtatttgttcaaatattaaaagaagttgaaaatagt
gcaacagatcaaaaagattctattgaagagtcaattcaagcaagattagaatttttagct
gctatctattctaatgatataactccagatcattttcgattatcaatatcacaagtagat
tgtttgtggaattgtttagttactcaactaccgcataattaccattttctaactttaagt
tggcttctcaaacaaactgacaatgaagatttgcatgctttaggtcttgatgcatttaaa
cacatctttgtaaacaagctgtcagagttaaatgcagaaaagatgacattgattggttta
agtctgtttcaaaagttatttggactgaccagattgtctaatgcgactccatttgtaaat
aaagagagtgatacagaagaatatgttcttggtacgcaacaattgtggaatattgcattg
aaagctgattgtctaaaagtttcaaatgaagcaatgaatgtcctgaatcatttatatctt
actgtaggcgaaaattcagtacaaaaagaagaagagtttattcagaattgcatgacagtt
ttaagagaaggtgttaatactattgaaaagaattatttacaatctttaaaatcaattcag
caagtgttaaagattctcaaaaatcatttgcaagcatacattaaaagacttgcatttcat
ttggaattgtggagtttaactggcagaaatgttgcaagccatcaaaatgtaaaaaaagtc
agcagtaaagatgttcctttgagaattgtatgtcaaccaacaggtgtcatagataagata
acattcaaaatgatgtcatgtgaccttcttgctactcttcgtgctcgtattacacattgg
tgtataggtgttcaagaaaggaaaaagccaaatgacaactccactgaattaaaaccacct
tttagacttatatcacatggtcatgagctaacccatgatttagacatgaagactttaagt
gaaataggaattcgagatcagcaattggtatatatttctatcatgaatatgcaaaaagaa
ggaatgttaaactcagtgcaacttccatactccttgcaaaatcctcctaattttgagtca
gtaccaatgatacaattacttagagaaaagaattttttcgaactatttaatttgcttgat
gttttatacaaagtaagcaattctgagagttatcaaaaagtttattgtgaaataagtaac
ttaccaaatagttcagttaatgacacacttgagcaatcatttgaagattcccgtgagtta
gttaaaccattatcagctagaagtttactaaataatacctgggaattaatacttatgctt
ccaactaatgaaaacttgaaggaaaagtacttaaaactttcatttaaagaagatattgat
tgggataatattttatgctttgaacaaaaatttatgcttctttatgttttgcaaatttta
gacagtataagtcttccatttgttcaaatttctaataaagaaaatactaatggagactca
agtggagactctgactcttcagttgttgacaaaggatcatctgtaagcaaccttgattat
gcttgggtacataaagtttttcagacaggtttagtaaagcatttattgcgttttattcta
aaagaagaaataaatcaagatgagtggtcaactagttgttttgcttatattatcaaactg
ataactcgaattggattggttagtgatgttgaccttggtcctgtaactaagaaaacttta
agaaaaacacatatatttagagcacgttatcgaagtactgaaacagataatattgttata
atccatcaatttagccaggaactgcttgatttgcttgatgaaaacttgtttcagagggtt
attaattttttatatcaaatatttgaaagtagtaatgacttatttacattaagcaaccaa
gatgttagagcttcagtggtatatcattgtctatcttttttggtatgttcagtgtcatgt
aatgaagagttacgcaaaaagcttcttcatcatgataaattttcatcgttactgttgcga
ttagttttttatgctccacagaggtctgtacgaactgaaggagcgcatggcatctataaa
ctttgtctttgcggtagtcaagttggtctaaacaaagttttaaatataatgttaaataag
ctttctgatttagtccaactgaaaaatatgtcagctgaacagctggcaagtttatcttca
cataaaattacaaatctaaattacaaagattatttttggttgttatgtcgcttgataaat
aagtataataaagttgatggtgaagatgaaatttgcattcgcactgcaattactgaagtg
tctatgtatataaaagaatcaaaaagttgtatcgataatggagattattgcttagttggt
ttgcttcaagtttgcacagctcttttgcaacatgatacagattttaaattacttccagaa
ggttttggtttaatgcaaaatgtctttagtaagattttatttaatcttccctcctctatt
agtgagatacaagagccgcatcatgaagcaaaaggttctcgtcttgcagcttatgaactt
ctgcttcagttagttagtggttgtaaagaaatgtatttagaacttcttactttttttatt
aaacatcacagaccaaatgagaaaaataaaaaccattgttcatatgggtggaattattgg
ccatatgagcaagaaagatcatctgttggttatgtaggattaatcaatttaggtgctacc
tgttatatggcatcatgtgtacaacagttgttcatgataccaaaagcaagatccgttatt
ttgaatgaagaaataacatctcaaactaagcattcagcaatcttaaaagaagttcaaaaa
atgtttgcatatcttcatagcagcattcgaaaagcatataatccaaaactgttttgtcgc
acatatacaatggataaacaacctcttaatacttgcgagcaaaaagatatgactgaattt
tttactgactttgtttccaagttagaagaaatgggacctgatctgaaagagctaatgcgt
gagctgttttgtggtgtaattacaaataatgttatttcactggattgcttacatgttagt
aaaacagaagaagaattttattcagtacgctgtacagttgctgatatgaaaaacctttat
gagtcattagatgaagttactgtcaaagatgtattagaaggtgataacaagtatacctgc
tcgcaatgtaatgataaagttcgagctgagaaaagagcatgtttcaagacattgccaaaa
gttttatgttttaacacaatgcgctatacttttaacatggtaactatgatgaaagaaaaa
gtaaatactcatttttcatttcctatgaaacttaatatggctgcatacactgaagattat
ctgcttatcaaaaactgcgatggagatcctgatgacaatccaagtcactggtataatcta
gcaggggtagttgtccacacaggcactgctgatggtggtcattactatagttttattcgt
gacagatgttcaaaagaaaataattggtatttatttaacgatgctgaagtaaaaacattt
gaccctatgcaaattgctgcagaatgctttggaggcgaaatgacaacaaaaacgtttgat
gcaatgactgagaagtatatggatttttcatttgaaaaaacgcatagtgcatacatgctc
ttttatgaacactgtgaaatggataaagagattcaaacaagtcacattaatttacctaaa
gatctacaagagttaattagtgaagacaaccatcagtttctgcaagataaacttgtattt
gaaccaaattattttagttttttatggcagttttgtaataatatccctaaaactttatca
gtttcagttacctttcatgttacaaagttagccatctcttttttgcttgaaactcttgtc
cattctcgtgaaaaacctcatataaaaaattgggtagaacttatagtgcatggttttgat
aattcacaaagtgcttgtgaatggttcttagactctatgacacaggatgattggtggctt
cagcagatgtttgtgaaatgtcctgctcaacatcttcgacaaatgtttggtcacttgtgt
ttaattccaataaaaaatttgagatcttcacaagtatatttttatacaatgagcacagaa
gaaggaatatccgatgaggacgatattggctcttgttcaccaatcacaagatttatcaaa
gctattttgatactacttgaagatattccacgtggttattgtaaaaatttagctgaacta
ttccactttatgtatcaatttctatcctttggtcatgaagagtgttcatttttactgcaa
atagatgccataacaatgttggttcaattttatagttgtctaaaagcaaatgaaccttca
gaatcaatagctgaagaagaggaagaactagatttagaagatgaagatatattatcaatg
tttcctgaggataagttttatccaaatgcattagagaaaatgattggctcaattgcttta
ttagtagaagctgctagggatggtccggaactacatttgtctgattcagatttacagtgt
tttacatcaacaaaagaggtgccattcttgtgtcaaattataatggatggtattaattta
agacaaacagcaaacattatatttcatttatcttgttacaatcaacaaatggcagaaatg
attgtgcatcttatactatcaactatacaaaagctttctattgatcagtcacaaaatttt
ttcaaagttttgtctctattaattgaggtaggagaaaatggtttacctggattgccatca
tatactgcaattgtgctctctaaaatatggcagacagcagaatatagtcctgcattaaca
ttagattggatttcaaaccatgtttcaagaaacaaagagattcataagtttgtgatagag
aatatggaaaaatgggttgaaaaatatctgatcattgatcctaatccaagaatacgtgga
ggtgcagcatatttattagtttctcttgtgccaaacatccactttcctcaatcatttaga
gggaggttgttttcaactccacaaaaacaaataaagatgagtgaagaagctaaactaatt
ttgaaaaaggtgtatgaatttcttttaaaaatgttgccgtcactaggaaaatattgtgat
aagtctcaccttggtacaacaagactagttaactattttacacttttgaattactgctgt
atatcaaatgatgaaaaagcaatgtttacacctttcagcattgatttatggagattatat
catccactaatgtctgaaccagatgtttcaattcatttcaacaagcaggcattgctgacc
ttttggtatcatgcttgtgaaaattttgaagacaatgttaagttcatcacagaaactcgt
gatgttgcattcaatattgcatacaactacattttgtcaaatgatgatcaggaggtaatt
tcgtataacaactctacacttccaatgtattatgggcttttaagacttgcttgtaattat
tcaaaacagttttgcaaaactttatcagtccatcctaacatgacatgggcatttgaacat
ttattgccaagagctaatcattatccacaggtgattgaagaacttttgaatttgataaaa
cttttttgcggttcaaaatacacatcaaatgaagatctcgtgttagcatcaacttttaaa
acaaaaacaatagaacttgtttgcagttcaattgaaggtcataatgcttggatgaccctt
gttaatgtacttcgggtgttgattacttcaaaagaagattgtttacatgtggtttacagt
aatggtttaaatccacttggcgaagctttttgtacacttcatctcatgtactatgaagcc
actgcatgtaatataacaaatgatattcttgaagttacaaatcttttacaaacagtactt
gggtattgccaatctcacatatctgacatagatccattatataaagttttgcattcttgg
gaagatcgagctgatgtaatgataaaagcattgtcgatgttaaattcatttgttgcaaaa
gaaatacaaaaatcttgtttagatttacttcatgagttattgcaaacataccctgaagaa
tttatagaaacagttgcccccattattcatcagtcacatcttgcaataagaatgacacca
caagaaaactttcattttggaccccattttcccaaaccaggtactcaaactaaggttaac
cgaaaattatcttcattgagaccaaaagaaccagaattgaatatgacacttcatcctcat
attattgaatctttttcaggagatgctgatggcgcatataaaatacagttatgtgattac
tttcatggctaccatttttttgttgataaaatgtgtcgttatggattaaatgctgaacct
atttctacaattattattgaaataagttgtttgttggctgttgaaatgcttccattgaag
tttcagttctttcctaaactttggcaagaggtttggagtaaatcttcagagaatacaaag
tttcgaagttgcattcatactttatttacatgtgattcatttctagagtttatggatgca
ctttttactgaagagcgtatattatttgatgactctgtgtattatacttttgcatgcata
ttttttcctaaggtttatagtaaagtcttgcctgatcatcaaagacaaaacttacttaat
tcaattgctttgtcaatgattgctgaagctacaaatattaagcaaatgggaaatgttgaa
tttgaaagagtatttcctaaattacatggggatttacgggcattatctttgttgatgtct
gttacagaaactaatgagttgacttcaactacctcacttgaggagtatgttaatagttta
ttggaacgacacaatcagctatcttcaactattcatataagatctgtttctgatgaaaaa
gattcttataaagatgagaaaggatctagtgatacgcctcatttaaaacaacagttgatt
gatgaatcaaataaacccagtgacgaggaacctcctaataaacgaataaaaggttctgaa
cctctacccggaccttcaaatagttctcatacaaatatttcaaattctggttcatcttgt
agcagtcctgattattctgatgattgcgacagttcatccgacgaaaaaaaaagttcagac
aaaacaaaaaataaaaaagaaagtgattgtggcgatgaaaaaccgtgcatttcaacttct
tttttaaataaaaaagttgtcaaaagtgctcagttaaaaaaagcttgcttgacattgctt
ggacttttatctcgtggtcaaaaaaaagaaaagactttgccggctgagattacatga

DBGET integrated database retrieval system