KEGG   Hydra vulgaris: 100198937Help
Entry
100198937         CDS       T01080                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hmg  Hydra vulgaris
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100198937
   00052 Galactose metabolism
    100198937
   00500 Starch and sucrose metabolism
    100198937
   00520 Amino sugar and nucleotide sugar metabolism
    100198937
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100198937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 502 aa AA seqDB search
MEIPEIRRRHDSYNFSNLAKHEAKEGCYSDINSLLETCPKEKLDEFRKNLIGFKQLFSRM
VDDDEPHLNWNSISPPPKELIKTYEEVMLKSSTDVKKLLDKLVVVKLNGGLGTSMGCTGP
KSVITVRNEFTFLDMQVQQIEFLNKKYGSNIPLVLMNSFNTHEDTKNLLRKYIHVNVNLH
CFQQSQYPRIYKESLRIVTKSISSGENIDFSWYPPGHGDMYQAFYNSGLLEQFIAEGKEY
VFVSNIDNLGATVDISILNYLLTLPMEERCDFVMEVTDKTRADVKGGTLIEVEKKLRLLE
IAQVPKEHVEDFKAVSKFRIFNTNNLWIRLEAIKQAVEENTLHLELILNHKQLDNGEKII
QIETAIGAAIKCFNKAIGVNVPRSRFLPVKTCSDLLLITSNLYHMNNGTLTMNPKRNFLT
TPLVQLGERFQKVKEYLNRFETIPDIIELDHLTVAGDVTFGRNVTLKGTVIIIANHGERI
DIPSGAVLENKIVSGNLRILNH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacctgaaattagaaggcgacatgattcttacaactttagtaatcttgcaaaa
catgaagctaaagaaggctgttactctgacatcaattcacttttggaaacatgcccaaaa
gaaaaattagatgagttcaggaaaaatctcataggctttaaacagttgttttctcgaatg
gtagatgatgatgaacctcatttgaactggaacagcatatctccacctccaaaagaattg
ataaaaacatatgaagaagttatgctaaagtcatctacagatgtaaaaaaattgttagac
aagcttgttgttgttaaactaaatggtggtcttggtactagtatgggttgcactggacca
aagagtgtaataactgttcgaaatgaattcacttttttagatatgcaagtccagcaaatt
gagtttcttaataaaaagtatggatcaaatataccattggttttaatgaactcttttaac
actcatgaggataccaaaaatcttttgcgaaaatatattcatgtgaatgttaaccttcat
tgttttcaacaaagtcaataccctcgtatttataaagaatccttgcgaattgtcacaaaa
tctatctcgagtggtgaaaatattgattttagttggtatccacctggacatggtgatatg
tatcaagcattttataattctggacttctggaacaatttattgcagaagggaaagaatat
gtatttgtttcaaatattgataatttaggagccacagttgatatatccattttaaactat
ttacttactctgccaatggaagagagatgtgattttgtcatggaagtaacagataaaacg
agagctgatgtgaagggaggtacacttattgaagttgaaaaaaagttaagattgttggaa
attgctcaagtacccaaagaacatgtagaagattttaaagcagtttcaaaattcagaatt
ttcaacacaaacaatctatggattagattagaagctattaaacaagccgtagaagaaaat
actttacatttggagttgatattaaatcataagcaattggataatggggagaagattata
cagattgaaacagctattggtgctgctatcaaatgctttaacaaagctattggtgtaaat
gtccctcgaagtcgttttcttcctgtaaaaacttgttctgatcttctattgattacttct
aatctttaccacatgaacaacggaacgcttacaatgaacccaaagagaaactttttaaca
acaccactggtgcaacttggagagcgttttcaaaaggtgaaggaatacttaaatcgtttt
gaaacaatacctgatataattgagttagatcatttgacagttgcaggtgacgttactttt
ggaagaaatgtaactcttaaaggtactgtaattatcatagccaatcatggtgaacgtatt
gatattccatcaggtgcggttctcgagaacaagatagtttcaggaaatcttagaatttta
aaccattaa

DBGET integrated database retrieval system