KEGG   Hydra vulgaris: 100198937Help
Entry
100198937         CDS       T01080                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase-like
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hmg  Hydra vulgaris
Pathway
hmg00040  Pentose and glucuronate interconversions
hmg00052  Galactose metabolism
hmg00500  Starch and sucrose metabolism
hmg00520  Amino sugar and nucleotide sugar metabolism
hmg01100  Metabolic pathways
Module
hmg_M00361  Nucleotide sugar biosynthesis, eukaryotes
hmg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100198937
   00052 Galactose metabolism
    100198937
   00500 Starch and sucrose metabolism
    100198937
   00520 Amino sugar and nucleotide sugar metabolism
    100198937
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100198937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100198937
NCBI-ProteinID: XP_012562043
Position
Un
AA seq 500 aa AA seqDB search
MEIPEIRRRHDSYNFSNLAKHEAKEGCYSDINSLLETCPKEKLDEFRKNLIGFKQLFSRM
VDDDEPHLNWNSISPPPKELIKTYEEVMLKSSTDVKKLLDKLVVVKLNGGLGTSMGCTGP
KSVITVRNEFTFLDMQVQQIEFLNKKYGSNIPLVLMNSFNTHEDTKNLLRKYIHVNVNLH
CFQQSQYPRIYKESLRIVTKSISSGEVGSWYPPGHGDMYQAFYNSGLLEQFIAEGKEYVF
VSNIDNLGATVDISILNYLLTLPMEERCDFVMEVTDKTRADVKGGTLIEVEKKLRLLEIA
QVPKEHVEDFKAVSKFRIFNTNNLWIRLEAIKQAVEENTLHLELILNHKQLDNGEKIIQI
ETAIGAAIKCFNKAIGVNVPRSRFLPVKTCSDLLLITSNLYHMNNGTLTMNPKRNFLTTP
LVQLGERFQKVKEYLNRFETIPDIIELDHLTVAGDVTFGRNVTLKGTVIIIANHGERIDI
PSGAVLENKIVSGNLRILNH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacctgaaattagaaggcgacatgattcttacaactttagtaatcttgcaaaa
catgaagctaaagaaggctgttactctgacatcaattcacttttggaaacatgcccaaaa
gaaaaattagatgagttcaggaaaaatctcataggctttaaacagttgttttctcgaatg
gtagatgatgatgaacctcatttgaactggaacagcatatctccacctccaaaagaattg
ataaaaacatatgaagaagttatgctaaagtcatctacagatgtaaaaaaattgttagac
aagcttgttgttgttaaactaaatggtggtcttggtactagtatgggttgcactggacca
aagagtgtaataactgttcgaaatgaattcacttttttagatatgcaagtccagcaaatt
gagtttcttaataaaaagtatggatcaaatataccattggttttaatgaactcttttaac
actcatgaggataccaaaaatcttttgcgaaaatatattcatgtgaatgttaaccttcat
tgttttcaacaaagtcaataccctcgtatttataaagaatccttgcgaattgtcacaaaa
tctatctcgagtggtgaagtaggaagttggtatccacctggacatggtgatatgtatcaa
gcattttataattctggacttctggaacaatttattgcagaagggaaagaatatgtattt
gtttcaaatattgataatttaggagccacagttgatatatccattttaaactatttactt
actctgccaatggaagagagatgtgattttgtcatggaagtaacagataaaacgagagct
gatgtgaagggaggtacacttattgaagttgaaaaaaagttaagattgttggaaattgct
caagtacccaaagaacatgtagaagattttaaagcagtttcaaaattcagaattttcaac
acaaacaatctatggattagattagaagctattaaacaagccgtagaagaaaatacttta
catttggagttgatattaaatcataagcaattggataatggggagaagattatacagatt
gaaacagctattggtgctgctatcaaatgctttaacaaagctattggtgtaaatgtccct
cgaagtcgttttcttcctgtaaaaacttgttctgatcttctattgattacttctaatctt
taccacatgaacaacggaacgcttacaatgaacccaaagagaaactttttaacaacacca
ctggtgcaacttggagagcgttttcaaaaggtgaaggaatacttaaatcgttttgaaaca
atacctgatataattgagttagatcatttgacagttgcaggtgacgttacttttggaaga
aatgtaactcttaaaggtactgtaattatcatagccaatcatggtgaacgtattgatatt
ccatcaggtgcggttctcgagaacaagatagtttcaggaaatcttagaattttaaaccat
taa

DBGET integrated database retrieval system