KEGG   Hydra vulgaris: 100198951Help
Entry
100198951         CDS       T01080                                 

Definition
STAM-binding protein-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100198951
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100198951
Peptidases [BR:hmg01002]
 Metallo Peptidases
  Family M67
   100198951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 440 aa AA seqDB search
MDPSARLKILTNKANDFPFDIKIPVIRYARSLKELERMAIIYAQESQVENAFILYMKLIT
LSVEKLPKHPQFSALDTEQRSIIKKRCALAITIAEDLKKEIKQLYEEEYRQLIEDKQDEV
KSVSQKITYVASQDNNNLHSSESLSPDFFASKSSSHTPSQNQKPSVSQSQELIPSQNQDD
NKISLPSYSTISLDQPSMSDCSTTSHVYPTAPPFKDFVDDALLLDDFKNTQYKHSDTFQP
NVNRSTKPLSMINDLKNNYEETHSSLNGKRFIILPADLTDKFLLLAASNTKRNIETCGIL
CGRLVQSQFRVTHLIIPKQHGTSDSCTTEKEEEMFDVQDKYDLITVGWIHTHPSQTCFLS
SVDLHTQCSYQQLLPEAIAVVCSPKYNNFGVYRLTMHGLKLITNCTQNGFHPHNKDPPLF
EESSGINIQDSYGITIVDLR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggatccttcggcaaggttaaaaattctgacaaataaagctaacgatttccctttcgat
ataaagataccagtaattcgttatgctcgttctttaaaagagctagagagaatggcaatt
atttatgctcaagaaagtcaagtggaaaatgcattcattttatatatgaaacttattact
ctttctgtggaaaagttaccaaaacatcctcaattctctgctttagatacagagcaaagg
agcattattaaaaagagatgtgcattagcaataacaatagctgaagatttaaaaaaagaa
atcaagcagttatatgaggaagagtatcgacaattgattgaggacaaacaagatgaagtg
aaatctgtatctcagaaaattacttatgtagcttcgcaagataataataatttacattct
tctgaatctctaagtccagatttttttgcaagtaaaagttcaagccatactcctagtcaa
aaccaaaaaccttctgtaagtcaaagtcaagaacttattccaagtcaaaatcaagatgat
aataaaatctcacttccttcttattcaactatctcccttgaccaaccttcgatgtcagat
tgttcaaccacttctcatgtttaccctacagctccaccttttaaagactttgttgatgat
gcactacttttagatgacttcaaaaacactcaatataagcactcagacacttttcaacca
aatgtaaatagatccactaaaccattgagtatgattaacgacttgaaaaataattatgaa
gaaacacactcatctttgaatggcaagcgctttattattttacctgcagatttgacagac
aagtttttacttttagctgcctctaatacaaaaaggaatattgaaacatgtggaatttta
tgtggtagattggttcaaagccaatttagggtcacacatttaataattcctaaacaacat
ggcacctccgattcttgtaccacagagaaagaagaagaaatgtttgatgttcaagataaa
tatgatcttataacagtaggatggattcatacgcatccttctcaaacgtgttttttatcc
agtgttgatttacatacacaatgctcctaccaacaactactacctgaggcaattgctgtg
gtttgttcgccaaaatataacaatttcggagtttatcgcttaaccatgcacggattaaaa
ctcataactaattgtactcaaaacggattccatccacacaacaaagatcctccacttttt
gaggagtcttctggaataaacattcaggattcttacggaattaccattgttgatttacgt
taa

DBGET integrated database retrieval system