KEGG   Hydra vulgaris: 100198990Help
Entry
100198990         CDS       T01080                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hmg  Hydra vulgaris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100198990
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100198990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 482 aa AA seqDB search
MVHRIPNPFRIIILGSGISGLSAAETVIKYSQVPCKVTLVECEPHVGGWLQSKVYEDGSV
FEHGPRSARSIGDTALQALNIMSDIGIGSKIIGIPRNKITSTRYIYANGKMNELPSSISS
MLFRQDPFSRSIISIIAKELFVEKNVTDEDESIYSFFCRRFNKEIADYLATSLCRGIFGG
DANVLSMKSCFRQVFEFEKKYGSVTRGMFFSKSGNAESLSDLALKAKREKWTSWTVQNGM
QALPKYWADSLRLNGVQILLDTKCEKLSFSNEKVFCTTNSCVLEADAVISSLPVCSLKSL
LTEANSTLSALLGSINFATMAVVNLEYVNEKVPFNGFGFLVPSNQPLNILGMTFDSVVLP
HPTQHNSAILTVMSGGAWFEEIFGNPNSCDENMIIESSVKNVRDILGFRSMPRRVLCKIQ
KNCIPQYYIGHDERVEQIKNFLKASDLPLLITGTSWGGVGINDAIINSKNDTLRWLASNH
MY
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatcgcataccaaatccttttcgtatcatcatacttggcagtggaatttcagga
ctttcagcggctgaaacagttatcaagtattctcaagtaccatgtaaagtgacattagtg
gaatgcgaaccacatgttggtggttggttgcagagtaaagtatacgaagacggtagtgtt
tttgaacatggtccacgttctgctcgatctattggtgatactgctttgcaagccttaaac
ataatgtctgatattggtataggtagcaaaataattggaattccaagaaacaagatcact
tctactcgttacatatacgccaatggtaagatgaacgaacttccttcgtcgatttcttct
atgttatttcgtcaagacccatttagccgctcgattatatcaataatagcaaaagaactt
tttgtagaaaaaaatgtcactgatgaagatgagagcatttatagttttttctgtaggcgc
ttcaataaagaaatagcagattatcttgctacttctctttgtcgtggtatatttggtggt
gatgcgaatgtactgagtatgaaatcctgttttcgacaggtgtttgaatttgaaaaaaaa
tatggttcggttacgcgagggatgtttttttctaaatctggaaatgctgagagcttatca
gatttagctttaaaagccaaacgtgagaaatggactagttggactgttcaaaatggaatg
caagctttgccaaaatactgggcagattctctaagattaaatggagttcaaatactatta
gacacaaaatgtgaaaaactttcattttcaaatgaaaaggttttttgtacgactaattcc
tgcgttttggaagccgatgcagtgatatcctcgcttcctgtgtgctctttaaaatctctt
ttaacagaggcgaatagtactttatctgcgttgttgggatcaattaattttgcgactatg
gctgttgtaaatctagaatacgttaacgaaaaggttccgtttaatggatttggatttttg
gttccgtctaatcagcctcttaacatattgggtatgacatttgattctgttgttcttccc
catccaacgcaacacaactctgcgattttaactgtgatgtcaggaggagcatggtttgaa
gagatttttggaaatccaaatagttgtgatgaaaacatgattattgagagttctgttaaa
aatgttcgtgatattttaggatttcgctccatgcctcgtcgcgtgttatgcaaaatacaa
aaaaattgtataccacagtattatataggccacgatgaaagagttgagcaaataaaaaat
ttcctaaaggcaagtgatctgcctctgttaattactggaacctcatggggaggagtggga
atcaatgatgctattattaattcgaaaaatgatacattgagatggttagcatcaaatcac
atgtattga

DBGET integrated database retrieval system