KEGG   Hydra vulgaris: 100199143Help
Entry
100199143         CDS       T01080                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hmg  Hydra vulgaris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100199143
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100199143
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100199143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 807 aa AA seqDB search
MTVVPELQNLLSLDGYLKDFKDEIIRRYQSFQTLVSYIEKNENGIDVFSEGYKQYGLHVT
ENGLMCREWIPAANEVFIFGDFNNWNSSSHKMLKKEFGKWEIIFPKNSDGSQQIKHLSKY
KLLIKTANGELLERISPWANYVVQNNTTTLMEPVFWNPQNPYIFKNKQPAKAKSLRIYES
HIGISSEEGKVASYKEFQNDVLPHIKDLGYNTIQLMAIMEHAYYASFGYQVTSFFAPSSR
YGTPDELKELIDEAHGMGIAVLLDVVHSHACKNVLDGLNKFDGTNGCFFHDNERGYHDLW
DSRLFDYKNWEVLRFLLSNLRWYINEFKFDGFRFDGVTSMLYNHHGLSFGFSGDYNEYFS
AATDTESLNYLQLANYMLHTLYPEIITIAEDVSGMPTLCRPVSEGGIGFDYRLAMAIPDQ
WIKILKEKRDEDWDMQNIVHTLENRRYKEKTIAYAESHDQALVGDKTLAFWLMDKEMYEY
MSVFKPLTPVIERGIALHKMIRLLTCGLGGEGYLTFIGNEFGHPEWLDFPRAGNNSSYHY
ARRQWSLVKDKTLRFNHLNEFDKAMMHLEEKYGWLHAEPGYVACKHNDDKVITFERGGLV
FVFNFNIHKSFVDYRVAVDTPGKYLLPYIYLVLLYSSPSLPVRALREKCAGYEVPQEIFT
VLSQSTAEEYLLGKDNDVNKNIENCQLNTILEAVEITQNRIERRIKALDISKSIGVELIH
PFVLKQCSSSISYPLYLIFKKSTEADTVPDIWKMANITPILSIPIDVLYTNFRKAFDRVS
HIKLRAKVYASSIVGMPLKWISDDKMQ
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgttcctgaacttcagaaccttcttagtttagatggttatttaaaagatttc
aaagatgaaataattagaagatatcaaagtttccaaactttggtgagctacattgaaaaa
aatgaaaatggtattgatgttttttctgaggggtataaacaatatggtttacatgtcaca
gaaaatggtttaatgtgtagagaatggattcctgccgcaaatgaagttttcatatttgga
gattttaataattggaattcatcatcacacaagatgttaaaaaaagagtttggtaaatgg
gaaataatttttccaaaaaactctgatggaagtcagcagataaagcatctttctaaatat
aagcttcttattaagactgcaaatggtgaactgctagagagaatatctccatgggcaaat
tatgttgttcaaaataataccactacattaatggaacctgtgttctggaatccacaaaac
ccatacatttttaaaaataagcaacctgctaaggcaaagagtttaagaatttatgaatct
catattggtatttcatctgaagaaggcaaagtagcttcttataaagaatttcagaatgat
gttctgccacacattaaagatttaggctacaatacaattcagctaatggcaattatggaa
catgcctattatgcatcatttggataccaagttacaagtttctttgcaccatccagtcga
tatggaactccagacgaactaaaagaactaatagatgaagctcatggtatgggtattgca
gttttattggatgttgtgcatagtcatgcttgtaaaaatgttttagatggattaaataag
tttgatggaacaaatggatgctttttccatgacaacgagcgtgggtatcatgatctttgg
gatagcagattgtttgattataaaaattgggaagtccttcgttttcttctttctaacttg
cgttggtatattaatgagtttaagtttgacggttttcggtttgatggtgttacttcaatg
ctctacaatcatcatggattaagttttggatttagtggtgattacaatgaatactttagt
gcagcaactgatactgaatctttgaactatctacaacttgcaaattatatgttgcataca
ctttatcctgaaattatcactatcgctgaagatgttagtggaatgcccacattatgtcga
cctgtttcagaaggtggtattggttttgactatagattggctatggctataccagatcaa
tggatcaagatcttaaaagagaaaagggacgaagactgggacatgcaaaatattgttcac
acattagaaaatcgacgctataaagaaaaaacaattgcatatgctgaatcacatgaccaa
gctcttgttggtgacaaaacattggcattttggctgatggataaggagatgtatgaatat
atgtcagtatttaaacctcttacacctgtcattgaaagaggtattgctttgcataaaatg
atcagattgcttacatgcggacttggtggtgagggttacttaacattcattggaaacgaa
tttggtcatcctgagtggcttgactttcctcgagcagggaataatagtagttatcattat
gctcgaagacaatggagtttagtaaaagataaaacacttcgattcaaccaccttaatgag
tttgacaaagcaatgatgcatttagaagaaaaatatggttggttacacgcagaacctgga
tatgtggcatgcaaacataatgacgataaagttatcacatttgaaagaggaggattagtg
tttgtattcaatttcaacatacataaaagttttgttgactatcgtgttgctgttgacaca
cctggaaagtatcttttaccttatatatatcttgtattgctatatagtagtccatcttta
ccagtgagggcattaagagaaaaatgcgcagggtatgaggtgccccaagaaatctttacg
gtattatcacaaagcactgcagaagagtatttattaggaaaagataatgatgtaaacaaa
aatattgaaaactgtcaactaaacacgatattagaagctgttgagataacacaaaatcgt
atagaaagaagaataaaggctcttgatatatcaaagtcaattggagttgaattaatacat
ccttttgttttaaaacaatgcagttcatcaatttcatatcctctttatttaatatttaaa
aaatctacagaagccgatactgtaccagatatttggaagatggctaatataacgcctata
ttgagtattccaattgacgttttgtataccaactttcgaaaagcattcgacagagtatca
catataaaattacgtgctaaagtttatgcgtccagtattgttggtatgcctcttaaatgg
attagtgatgataaaatgcaatag

DBGET integrated database retrieval system