KEGG   Hydra vulgaris: 100199173Help
Entry
100199173         CDS       T01080                                 

Definition
cGMP-dependent protein kinase egl-4-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
hmg  Hydra vulgaris
Module
cGMP signaling
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100199173
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100199173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 741 aa AA seqDB search
MGNSASLRKSTDTMTVDGEKLDFARLKHLYPKLRQDLKKKDELIDEKNKKLSGYELEILN
LKKEIRQLQSVIEATRNTNITNDVIIEEEDEDNNGNSLSRHSMNYPKARFIEVVKTVRNK
RFAVSAESGKELQNLDFPKIPKSTDVKEFISQAVLKNNFLKHLEECQVKEIVLFMTQKSF
KRGEYIIKEGDMGNALFVSYIGQLEISQGDKILGKPLRPGELFGELAILYNCTRTASVKA
IDDVEVWYLERHVFQAVMQKTGIMRREEHYNFLHSVPVFKDLPNDTLLKIVEVIEEEFYE
DGEFIVREGERGDSFYILKHGFVKVLQMIEGKDEPVEIRQLSQGEYFGEKALLGEDVRTA
SVVASTGGVHCLVIERDVFMSFIGDLSYLKNKDYGDKLRKAVNVSRANSLSNKTIPDTVS
PEFLTAKLTDFKLVATLGVGGFGRVELVQDKRNKERTYALKSLSKHYVVETKQQEHVFNE
KKILMSLDSQFIIKLYKTFKDDRYVYLLLEVCLGGELWTILRDRDYFEEAACRFYIACVV
EAFEYIHKRGIIYRDLKPENLLMDSQGYIKIVDFGFAKKIPSGTKTWTFCGTPEYVPPEI
ILNKGHDSSADYWSLGILIYELMVGNPPFTSSDPMSTYNIILRGIEVLEFSNLVTKNAQN
LIKRLCKENPMERLGNQKDGVDDIRKHKWYQGFHWSGLRNRSLQAPIVPKIRNITDYSNF
DYFSPLKEKPQKEFSGWDENF
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacagcgcaagtttgcgtaaaagtaccgacacaatgacagttgatggcgaaaaa
cttgactttgcaagacttaaacacttgtatcctaaattacgacaagatcttaaaaaaaaa
gatgagttaattgatgaaaaaaataaaaaactttctgggtatgaactagagattttgaat
ttaaaaaaagagattcgtcaattgcaaagcgttattgaagctactcgcaatactaatatc
acaaacgatgtcattattgaagaagaagatgaagataataatggtaactctttatctcgt
cattcaatgaattacccaaaagctagatttattgaagttgttaaaacagttcgaaacaaa
agatttgcagtttctgctgaaagtggaaaagaacttcaaaatttagactttcctaaaata
ccaaaaagtactgacgtaaaggagtttataagtcaagccgtacttaaaaataatttctta
aaacacttagaagaatgtcaagtcaaagaaattgttttgtttatgacacaaaaatctttt
aaacgaggagaatacattattaaagaaggcgatatgggaaatgcgttgtttgtatcgtat
ataggacagcttgaaataagtcaaggtgataaaattctcggaaaacccttaagacccggc
gaattgtttggcgagttagctattctttacaattgtacccgcactgcttctgtgaaagca
attgatgatgttgaagtatggtatttggaaagacacgtttttcaggcagtaatgcagaaa
actggtataatgagaagagaggagcattacaattttttgcatagtgttccagtatttaaa
gacctaccgaacgatactctgttaaaaattgtagaagttattgaagaagagttttatgaa
gatggagagtttatagtaagagaaggggagcgcggagattctttttatattctgaaacat
ggtttcgttaaagtgttacaaatgattgaaggtaaagatgaaccagttgaaattcgtcag
ttatctcaaggtgaatattttggggaaaaggcgttattaggagaagatgttcgaacagca
agtgttgttgctagtactggtggcgttcattgcttggtgattgaaagagatgtttttatg
agctttattggtgatttatcatacttaaaaaataaagattacggcgataaattacgaaaa
gccgttaatgtatcgcgagcaaactctttaagtaataaaacaattccagacactgtgtca
cccgaatttttaaccgcaaaactgactgactttaaactggttgctactcttggtgttggt
ggctttggtcgcgtagagttagtacaagataaacgcaataaagaacgcacttatgcgctt
aagagcttatcaaagcattatgttgtggaaacaaaacagcaagaacatgtctttaatgag
aaaaagattttaatgtctcttgatagtcaatttattataaagctatataaaacattcaaa
gacgatcgctacgtatatttgttattagaagtttgtttaggcggtgagttgtggactatc
ctaagagatcgagattactttgaggaagcagcctgtcgtttttatatagcgtgtgttgtt
gaagcatttgaatatattcacaaacgtggtattatatacagagatttaaaaccagaaaac
ttactcatggatagccaaggttatataaagatagtagattttggttttgctaaaaaaatt
ccatccggtacgaaaacatggacattttgtggaacacctgaatatgtaccaccggaaatc
attcttaacaaaggacacgattcttctgcagattattggtcattaggaattttaatttac
gaattaatggttggcaaccctccattcacgagctctgaccctatgagtacttacaatatt
atattacgagggatagaagttttggagttttccaatctagttaccaaaaacgctcaaaac
ttaataaaacgcttatgcaaagaaaaccctatggaacgattaggaaatcaaaaagacggt
gtagacgatatacgtaaacacaaatggtatcaaggttttcattggagcggtttacgcaac
agaagtttgcaggcacctattgttccaaaaattagaaatattacagattactctaatttt
gactatttctctcccttaaaagaaaaacctcaaaaagagttttctggttgggatgaaaat
ttttaa

DBGET integrated database retrieval system