KEGG   Hydra vulgaris: 100199340Help
Entry
100199340         CDS       T01080                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hmg  Hydra vulgaris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:hmg01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:hmg00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hmg00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 473 aa AA seqDB search
MLTCRSLQKLPLHRISRAFKGNKDAFVFITSVQQKHRSVTNLYNLQNKSRFWSQTEIRRN
LSITTLKFNEFQIVHTPPFAESVTEGDVRWEKAVGDAVSIDEVVGEIETDKTALPIVSPA
SGFIDELFVVDGGRVGKGDQLFKLRLGGAQPKKNVEKVIEDKLPQSVPESKTSSEPSPVL
PPSHVADKSTIQTPIAVRKPTPPPSISQSNFPSSSITPDTSSSINIEVKEVKTAPTRISG
TRNETKVKMNRMRLRIAQRLKEAQNTNAMLTTFNEVDMSKVMEMRKNYKDIFLKVHKLKL
GFMSCFLKASSNALTQMPIVNAVIEDNYVVYRDFVDISVAVATPKGLVVPVLRDVDKMNF
ADIERGMNLLGEKARDGTLAVEDMDGGSFTISNGGVFGSLMGTPIINPPQSAILGMHGIF
DRPVAINGKVEIRPMMYIALTYDHRLIDGREAVTFLRKIKQNVEDPQAMFLDI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcttacttgtagatctttgcaaaaattacctttgcaccgaatttcaagagcctttaaa
ggaaataaggatgcatttgtatttattacgtctgtgcaacagaagcatcgctcagttaca
aatttatataatttgcaaaataaatccagattttggtcacaaactgagataagaagaaat
ttaagcattacaactctaaagtttaatgagtttcaaatagttcacacacctccttttgca
gagtctgttactgaaggggatgtaagatgggaaaaagctgtgggtgatgcggtatcaata
gatgaagtagttggggaaatagagacagacaaaacagccttgcctattgtttcaccagct
tcaggttttattgatgaactttttgttgttgatggtggtcgtgttggaaagggcgaccag
ctttttaaattacgattaggaggtgctcagcccaaaaaaaatgtagaaaaggtcatagaa
gataaattaccacagtcagttcctgagtctaagaccagctcagaaccttcacctgtattg
cctccatcacatgttgctgataaatccaccattcaaactccaatagcagttcgtaaacca
actccaccaccttctatatctcagtcaaattttccttcaagttcaataactccagatacg
tcatcatcaataaacattgaagtaaaagaagtaaagacagcaccaactcgtattagtgga
actagaaatgaaacaaaagttaaaatgaaccgaatgcgccttcgaattgctcaaaggtta
aaagaagctcaaaatacaaatgcaatgctaaccacattcaatgaagttgatatgagtaaa
gtaatggaaatgcgaaaaaattacaaagatattttcttgaaagttcacaaattaaaactt
ggttttatgtcatgttttttaaaagcatcttccaatgccctcactcaaatgccaattgtt
aatgctgtgattgaagataactacgtggtatatcgtgattttgtagatataagtgttgct
gtggccacgccaaaaggtttagttgttcctgttcttcgagatgtagataaaatgaacttt
gcagacattgaacgtggaatgaatttattgggagaaaaggcacgggatggcacattagct
gtagaagacatggatggtggttcatttacgatttccaacggtggtgtttttggatctcta
atgggcactccaattattaatcctcctcaatcagcaattcttggaatgcatggaattttt
gatcgacctgttgctataaatggaaaggtggaaattcggccgatgatgtatatcgctcta
acttatgatcaccgtttgattgatggaagggaagcagtgacttttttgcgtaaaattaaa
caaaacgttgaagacccacaagcaatgtttttagatatttaa

DBGET integrated database retrieval system