KEGG   Hydra vulgaris: 100199769Help
Entry
100199769         CDS       T01080                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100199769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
ETIFGYKGLNIQLYYHAGSLLTYLNMEYHEQIPRSYGIKPDPVIPKIVEQIPQVFVVKGF
ISNRDEFISKLEKEDSFTPMGNKIHSYFHDDTEYEIYEADIFTPRLKEYHERLQTFILWY
IDAASFIDIDDEKWHFFLLFEKKKSIAPIYNIVGYMTVYHYYSYPDKFRPRISQTLILPP
FQRKGHCVQLLHAVNKHYISNPDAVDITVEDPSEDFVRCRDFVDCQNCLKLNSFSKDKLL
TDYSDDMRKDALEKFKITKSQARRVYEILRLRVTDISNNAMYHQYRLCVKKRLNLPFQKQ
ARDMEKLRAVLSSEEYNSAMVGQSNEERIQRLDEAYKLLEAEYFKVIDRLD
NT seq 1057 nt NT seq  +upstreamnt  +downstreamnt
tgaaactatatttggatacaaaggacttaacatacaattatattatcatgccggaagttt
actgacttatcttaatatggaatatcatgagcaaataccaaggtcatatggaatcaagcc
agatccagtgatacccaaaattgttgaacaaatcccacaagtgtttgttgttaaaggttt
tatttctaatcgagatgagtttatttcaaaacttgaaaaagaagacagttttacacctat
gggcaacaaaattcattcttattttcatgatgatacagaatatgaaatctatgaggctga
tatatttactcctcgtctaaaagaatatcacgaaagactgcagacatttattctttggta
tatagatgcagcatcatttattgatattgatgatgagaaatggcatttctttttgttgtt
tgaaaaaaagaaatcaattgctccaatatataatattgtcggatacatgactgtttacca
ttattattcatatcctgataaatttcgaccacggataagtcaaacattgattcttcctcc
atttcaaagaaaaggtcactgtgttcaacttttacatgctgttaataaacactatatttc
aaatcctgatgcagtcgatataacagttgaagacccatcagaggattttgttcgctgtcg
agattttgttgattgtcaaaattgtttaaaacttaacagtttttcaaaagataagcttct
tactgattattcggatgatatgaggaaggacgcattggagaaattcaaaataactaagtc
gcaagcgagaagagtttatgaaatacttcgcctgcgagttactgacatttccaacaacgc
tatgtatcaccaatatagattatgcgttaaaaaacggctgaatcttccatttcagaaaca
agcacgtgacatggaaaaattgcgggcggttttgtcttctgaagaatataactcggcaat
ggttggtcaatctaatgaagaaagaattcaacgcttagatgaagcatataaactattaga
ggcagaatattttaaggttatagatagattagactaa

DBGET integrated database retrieval system