KEGG   Hydra vulgaris: 100199848Help
Entry
100199848         CDS       T01080                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L3-like
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100199848
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100199848
Ubiquitin system [BR:hmg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100199848
  UBL-specific proteases (ULPs)
   100199848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 230 aa AA seqDB search
MIGDRWLPLESNPDVMNRYIKALGVDTDKWKFVDVYGLDDELLEMVPHPACAILLLFPIN
SNYEKNRIEEEEKVRSEGQFVSSCLYFMPQTISNACGTLGVIHAIANNMEVLQCEGLLKA
FIEQSKDLSLSEKALMLQNDSGITSCHDSSALEGQTLAPSREESVNLHFIALVQKEGYLY
ELDGRRPFPINHGRSNEETFLKDAAIVCKKFMEFDKESLQFNVVALAKVN
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgataggcgataggtggcttccattggaatctaatcctgatgtaatgaaccggtatatc
aaagcacttggtgttgatacagataaatggaaatttgtagatgtgtatggtttagatgat
gaattgcttgaaatggttcctcaccctgcatgtgcaatacttcttttatttcctattaat
agcaattatgaaaaaaatagaattgaagaagaagaaaaagtgcgtagtgaaggtcaattt
gtatcctcttgcttatattttatgccacaaacgatcagtaatgcctgcggcaccctaggt
gtaattcatgcaatagcaaataacatggaagttctacaatgtgaagggttgttaaaagcg
tttattgagcaaagcaaagatttatcactttctgaaaaagcgcttatgttgcaaaatgat
tcaggtattacaagttgccatgatagtagtgctttagaaggccaaaccttagctccttct
cgtgaagaaagtgtaaatttacattttattgctctggttcaaaaagaaggttatctctat
gagcttgatggtcgacggccttttcctattaatcatggccgttctaatgaagaaaccttt
ttaaaagatgcagcaattgtctgcaaaaagtttatggaatttgataaggaaagtttacag
tttaatgttgttgcattagctaaagtaaattaa

DBGET integrated database retrieval system