KEGG   Hydra vulgaris: 100199910Help
Entry
100199910         CDS       T01080                                 

Definition
(RefSeq) histone deacetylase 2-like
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hmg  Hydra vulgaris
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100199910
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100199910
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100199910
   HDAC complexes
    Sin3A-HDAC complex
     100199910
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100199910
  Chromatin remodeling factors
   NuRD complex
    100199910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 311 aa AA seqDB search
MEVYQPNAVVLQCGADSLSGDRLGCFNLSLKGHASCVAFIKKFNLPLLMLGGGGYTIRNV
ARCWTYETSVALDADIPNELPYNDYFEYFGPDFKLHIQPSNMQNQNTTDYLDKIKTRLYE
NLRMIPHAPGVQMAPIPEDGVHEESDDEEENAKSSDQRISIRASDKRIVNEAEYSDSEDE
GEGRRDEKSYKTPRKKIKPGSPITTMVMDSIKTTEKEVSNQPIKDNENGSSSDNSLSEIP
GKSVADLAVAATPNSEGLVSIINNQSKPDIEAMEIDQSVENSLNDLPKNEVKSSVAEISS
NTQPSFEDTST
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatcaaccaaatgctgttgtgttacagtgtggtgctgattcattgtcagga
gaccggcttggttgtttcaatttatcattaaaaggtcatgcatcatgtgtagcatttatt
aaaaagtttaatcttcccttgctaatgcttggtggaggaggatacacaatccgtaatgtt
gcacggtgctggacatatgaaacatcagttgcgcttgatgctgatatacctaatgaacta
ccctacaatgattactttgaatattttggacctgacttcaagttgcatattcagccatca
aatatgcagaatcaaaacactacagactatctagataaaatcaaaactcggctatatgaa
aatcttagaatgatacctcatgctcccggtgttcagatggcgcctattcctgaagatgga
gttcatgaagaaagtgacgatgaggaagaaaatgctaaatcctctgaccaaagaatttca
atacgagcatctgataagcgtattgtgaatgaagctgaatattcagactcggaagatgaa
ggagaaggccggcgtgatgaaaagtcttataaaacaccaaggaaaaaaattaaaccagga
agcccaattactaccatggttatggattcaataaaaacgacagagaaagaagtttcgaat
caacccatcaaagataatgagaacggaagttcatcagacaattctttatcagaaattcct
ggaaaaagtgtagctgatttagctgttgccgctacacctaatagtgaaggattggtttca
attatcaataaccaatcaaaaccagatattgaagccatggaaatcgatcaatctgttgaa
aactcactgaatgatctacctaaaaacgaagttaaaagttctgttgcagagatttcttca
aatacccagccttcgtttgaggatacaagcacttga

DBGET integrated database retrieval system