KEGG   Hydra vulgaris: 100199949Help
Entry
100199949         CDS       T01080                                 

Definition
mitogen-activated protein kinase kinase kinase 12-like
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100199949
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   100199949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 493 aa AA seqDB search
MGFLTSSTKLDCVEPDIVKDVPEGAIGTPETSTSINSVHSQNLPFKNTLSIKSILGYIEP
FFNICRPKTIKKDNNWEIPFEDIKELEWIGSGAQGAVFLGKWKSEEVAIKKVRSEKDTCI
KDLIYLEHKNVVKFRGVCSQGPGYSLVMEYCPFGQLYEALRRDKEVTPTLLVNWSRQIAD
GMAYLHSHKIIHRDLKSPNILISYNDTLKISDFGTWKPMSEKSTNMTFTGTVAWMAPEVI
RNDPCSEKVDIWSYGVLVWELLTEEIPYKGVDYSALIWGVGNNSLKLPIPSSCPEGFKLL
LNLCWNNKAKNRPTFRQILMHIDIAATDVLTMPKKKYFNKQLSWRHEVVDYFKWLKSQGS
QLTLVDNDFMEKKEEEIRQARKIRLEYEERLMKANELYRELNDCMVQLQLREEELKRREI
ELNVKKAVTNEAENCEDNEVKCCEESEFCAHNEKKKNIEIAKISRKHMKHMHYVKIGLKK
RIHGCNAPIFTEF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttaacttcttctaccaaacttgattgcgtagaaccagatatcgtcaaagac
gttcccgagggagcaatcggaaccccagaaacatctacaagtattaattcagttcattca
caaaatcttccgtttaaaaatactttatcaataaaaagtatactcggttacattgaacct
ttttttaacatatgtcgaccaaaaaccatcaaaaaagacaacaattgggaaatacctttt
gaagatataaaagaactagaatggattggctccggagcccaaggtgctgtttttttaggt
aaatggaaaagtgaagaagttgctataaaaaaagttcgatcagaaaaagacacatgcatc
aaagacctaatatatttggagcataaaaatgttgtaaagttcagaggagtatgctcacaa
gggcctggatactccttggttatggagtattgcccttttggacagttatacgaggcatta
agaagagataaggaagtaactccaactctgcttgttaattggtctagacaaatagcagat
ggaatggcatatttgcattctcataaaataattcacagggatctaaaatctccaaatatt
cttatttcatataatgatactttaaaaatctctgactttggaacctggaaaccaatgtct
gaaaaaagcacaaatatgacttttactggaacagttgcttggatggctccagaagtcatt
agaaatgatccatgttcagagaaagttgatatttggtcatatggtgtgttagtttgggag
ttactaacagaagaaattccctataaaggtgttgattactcggcattaatatggggagtt
ggtaataatagtttgaaattgccaattcctagcagttgtccagaggggtttaaactatta
ttaaatttatgctggaataacaaagcgaaaaatcgacctacatttcgacagatacttatg
catatagatattgctgcaactgatgtcttaacaatgccaaaaaaaaaatattttaacaag
cagttatcatggagacatgaagttgtggactattttaaatggttgaaatcgcaaggctct
caactaacactagtcgacaatgatttcatggaaaaaaaagaggaagaaattcgacaagct
cgaaaaatcagacttgaatatgaggagcgtttaatgaaagcaaacgagttgtatcgggaa
cttaatgattgcatggttcagttgcaactaagggaggaggagttaaaaaggcgtgagatt
gagttaaatgtgaagaaagctgttacaaatgaagcagaaaattgtgaagataatgaagta
aaatgttgtgaagaaagtgagttctgtgcacataatgaaaaaaagaaaaatatagagatt
gcaaagataagtagaaaacatatgaaacatatgcattatgttaaaattgggttaaaaaaa
agaatacatggttgcaacgctcccatttttactgaattctaa

DBGET integrated database retrieval system