KEGG   Hydra vulgaris: 100200166Help
Entry
100200166         CDS       T01080                                 

Definition
(RefSeq) guanylate kinase-like
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hmg  Hydra vulgaris
Pathway
hmg00230  Purine metabolism
hmg01100  Metabolic pathways
Module
hmg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100200166
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100200166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 RsgA_GTPase ABC_tran AAA_33 RNA_helicase Rad17 MMR_HSR1 AAA_28 dNK AAA_22 AAA ATPase_2 G-alpha NACHT AAA_29 AAA_5 RuvB_N ArgK AAA_24 NTPase_1 DUF815 Viral_helicase1 Mg_chelatase AAA_14 NB-ARC Septin TsaE AAA_17 KAP_NTPase Zeta_toxin AAA_30 PRK SRPRB Rep_2 Cytidylate_kin MobB cobW AAA_23 Adeno_IVa2
Motif
Other DBs
NCBI-GeneID: 100200166
NCBI-ProteinID: XP_012556985
Position
Un
AA seq 209 aa AA seqDB search
MGLVCSGDASIKSARKMTQKLHPVVLSGPSGCGKSTLIKKLTTEFPTKFGFSVSHTTRAP
RPNEIDGKDYHFTTLEAINQKIEAGEFIESATFSGNKYGTSKKAVHDVLETGKICILDID
SQGVKSIKKTDLHCVLIFIKPPSLEELERRLRERGTETEEAIQKRLESAKAELDYATEAG
SYHFTIVNDDLERAYKELKEIISKEISQL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgggattggtctgttccggcgatgcttcaataaaatcagctcgcaaaatgacgcaaaag
ttacaccctgttgtgttatcaggaccaagtggctgtggtaaatctacacttataaaaaag
ttaactacggaatttccaaccaaatttgggtttagtgtttcacatacaacaagagctcct
cgtcctaatgaaattgatgggaaagactatcactttacaaccttggaagctataaaccaa
aagattgaagctggtgagtttatagaaagcgcaacatttagtggaaataaatatggaaca
agtaaaaaggctgtgcatgatgtgttagaaactggaaaaatatgcatactggatattgac
tcacagggtgttaaaagtattaaaaagaccgaccttcactgtgtgcttatatttatcaag
ccgcctagccttgaggagttggaaagaaggttaagagagcgtggtactgaaacagaagaa
gcaattcaaaaaagacttgaatctgctaaagcagagttagattatgctacagaagctggt
tcctaccactttaccatagttaatgacgatttagagcgagcttataaagagctaaaggaa
attatatctaaggaaatttcacagttatga

DBGET integrated database retrieval system