KEGG   Hydra vulgaris: 100200166Help
Entry
100200166         CDS       T01080                                 

Definition
guanylate kinase-like
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
hmg  Hydra vulgaris
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100200166
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100200166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 179 aa AA seqDB search
MGLVCSGDASIKSARKMTQKLHPVVLSGPSGCGKSTLIKKLTTEFPTKFGFSVSHTTRAP
RPNEIDGKGRCKKAVHDVLETGKICILDIDSQGVKSIKKTDLHCVLIFIKPPSLEELERR
LRERGTETEEAIQKRLESAKAELDYATEAGSYHFTIVNDDLERAYKELKEIISKEISQL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggattggtctgttccggcgatgcttcaataaaatcagctcgcaaaatgacgcaaaag
ttacaccctgttgtgttatcaggaccaagtggctgtggtaaatctacacttataaaaaag
ttaactacggaatttccaaccaaatttgggtttagtgtttcacatacaacaagagctcct
cgtcctaatgaaattgatgggaaaggtagatgtaaaaaggctgtgcatgatgtgttagaa
actggaaaaatatgcatactggatattgactcacagggtgttaaaagtattaaaaagacc
gaccttcactgtgtgcttatatttatcaagccgcctagccttgaggagttggaaagaagg
ttaagagagcgtggtactgaaacagaagaagcaattcaaaaaagacttgaatctgctaaa
gcagagttagattatgctacagaagctggttcctaccactttaccatagttaatgacgat
ttagagcgagcttataaagagctaaaggaaattatatctaaggaaatttcacagttatga

DBGET integrated database retrieval system