KEGG   Hydra vulgaris: 100200309Help
Entry
100200309         CDS       T01080                                 

Definition
histone-lysine N-methyltransferase SETD2-like
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
hmg  Hydra vulgaris
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100200309
Enzymes [BR:hmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100200309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 655 aa AA seqDB search
MEAQLKEQSDKVSFNPNLQKVGFNEVECSDDSDIFLHAGIKVKANQEISIDTEFDSEALL
LANSQKLEKQCLSNNIYDTVTPNNVDDTLTAKKICDTVTADVNYNEMENQVENTVTNKVN
DIVTENESETVKTKKSDARLLYKESIQFNISCERKNDQDIENKNSQKAQTQKTSEKFEEV
NVFSNPDIFAQLNNSNEDNDNDSEEFLKRNESDRVSNELEDNGDDDLAPLTFDSTETNIY
LIDKEKSRSSKEVRRMICECVFEPDDPFFVGCDENCLNRLLMIECNNRCPTREFCTNRNF
QKQEDFYENEGSFVSEYCGEVVDYTEFHRRTKLYNAEGMNHYYFMTLKTNEIIDATKKGS
KSRFINHSCDPNCITQKWTVNGFLRVGFFALRYIEAGEELSFDYQFQRYGEKPQKCYCGA
AICRGVIGVEQSGPIPSYIEKISELNELLGSTWLLKDNNQVLELIRLMVKVETLHERREL
LKILQSTTNSNALKSFVRYKGLSLLWTWMVDAPSHKTKYKILKTLKHIPIPNKNELDDSK
VVHIVSKWLKKPISQERSSSEEQQSGSENELKIDEFSESPLNDASEDTSSSSNNERIYKS
ADAESTEEGEIFDPDDEKIRKIKKKLKSKSDNSSKENEIRNIAISLLEEWKALKV
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcaactcaaagaacaatcagataaagtttcatttaatcccaatctccagaaa
gttggttttaatgaagttgaatgttcagacgacagtgatatttttttacatgctgggatc
aaagttaaagcaaatcaagaaattagtatagacactgagtttgattctgaagctttatta
ctggctaatagtcagaagttagaaaaacaatgtttatcaaataatatttatgatactgta
acaccgaataatgttgatgatactttaacagcaaaaaagatttgtgatactgtaacagca
gatgttaattataatgaaatggaaaatcaagttgaaaatactgtaacaaataaggttaat
gatattgtaacagaaaatgagtcagaaactgtaaaaacaaaaaaatctgatgcacgttta
ttatataaagagagtattcaatttaatatttcttgtgaaagaaaaaatgatcaagacata
gaaaacaagaactcacaaaaagcccaaactcaaaaaacttcagaaaagtttgaggaagta
aatgtattttcaaatccagatatttttgctcaattaaataactctaatgaagataatgac
aatgattctgaagaatttctcaaaaggaatgaatctgatagagtttctaatgaactggaa
gataatggtgatgatgatttagcaccacttactttcgattcaactgaaacaaatatttat
cttattgataaagaaaaatcaaggtctagtaaagaagtaagaagaatgatttgtgaatgt
gtatttgagccagatgatccattttttgtggggtgtgatgaaaactgtttgaatcgtcta
ttgatgattgagtgcaacaatagatgtcctacaagagaattttgcactaacagaaacttt
caaaaacaagaagacttttatgagaatgaaggttcatttgttagtgagtattgtggtgaa
gttgttgattatacagagtttcatagaagaacaaagttatacaatgctgaaggaatgaat
cattactactttatgacgctgaagactaatgagattattgatgcaacaaagaaaggaagc
aaatcgcgttttattaatcatagttgcgatccaaattgtataactcaaaagtggaccgta
aatggttttttacgagttggattttttgctttgcgttatattgaagccggagaagagttg
agttttgactatcaatttcaaagatatggagaaaaaccccaaaaatgttactgtggagca
gccatttgtcgaggtgttattggagtagaacaaagtggaccaatacctagttatatagaa
aaaataagtgaattaaatgagcttcttggttctacatggttgttgaaggataataatcaa
gttttagaactgataagattaatggtaaaagttgaaacactccatgagcggcgagaattg
cttaaaattcttcaatctaccaccaactcaaatgctctcaaatcttttgttcggtataaa
ggtttgagtttgttgtggacatggatggttgatgctccatcacacaaaacaaagtataaa
attttaaagactctgaagcacattcccataccaaataaaaatgaactagatgacagcaaa
gttgttcatattgtttcgaaatggttaaaaaaaccaatatctcaagaaagaagttcaagt
gaagaacaacagtctggaagtgaaaatgaacttaaaattgatgaattttcagagtcccca
ttaaatgatgcaagtgaagatacaagtagctcttcaaacaatgaaaggatatataaatct
gctgatgcagaatcaactgaagaaggagaaatatttgatcctgatgatgaaaaaatcaga
aaaataaaaaagaaactcaaaagcaaatcagacaattctagtaaagaaaatgaaatacgc
aatattgccatatccttacttgaagaatggaaagccttgaaggtataa

DBGET integrated database retrieval system