KEGG   Hydra vulgaris: 100200477Help
Entry
100200477         CDS       T01080                                 

Definition
(RefSeq) aurora kinase C
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100200477
Protein kinases [BR:hmg01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   100200477
Protein phosphatases and associated proteins [BR:hmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100200477
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100200477
   Spindle formation proteins
    100200477
  Sister chromatid separation proteins
   Aurora kinases
    100200477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 100200477
NCBI-ProteinID: XP_012558808
UniProt: T2MJJ8
Position
Un
AA seq 339 aa AA seqDB search
MNALKDNNFQNSSKGTVKTMLQKSDKPSSLEKENQDQKEPKNQNKENPPPPIDKCWSLSD
FDIGKPLGKGKFGSVYLAREKQSHFIVALKVLFKSQLMKAAVEHQLRREIEIQSHLKHPH
ILRLYGYFYDAKRVFLILEYAPQGELYKHLTKSERFNEAKSATYISQLASALEYCHSKKV
IHRDIKPENLLLGMKGELKISDFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKVHDEKVDL
WSVGVLCYEFLVGKPPFETESHDHTYQLISSVKYSFPDYVSSGARDLISQLLRKKPSDRL
PLADVLKHPWIQQHSSMFNKQKVSVNQTPTTSVSSLSSS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattaaaagataataattttcagaattcgtctaaaggaactgtaaaaacaatg
cttcaaaaatctgacaaaccaagtagtttagaaaaagaaaatcaagatcaaaaagaaccc
aaaaatcaaaataaagaaaatcctcctccgcctattgataaatgttggtctctatctgat
tttgatattggcaaaccacttggaaaaggtaaatttggaagtgtctaccttgcaagagaa
aaacagagtcattttattgttgcattaaaagtcttgtttaaatcacaacttatgaaagca
gctgttgagcatcaattgagaagagaaattgaaatacaatcacacttaaaacatccacac
atattaagattatatggctacttctatgatgcgaagcgcgtgtttcttatactggagtat
gcaccacaaggagagttatataaacatctaacaaaatcagaacgttttaatgaggccaag
tcagcaacatatatttcccagttggcttcagctcttgaatattgtcattcgaagaaagta
atccatagagatattaagccagaaaatcttttacttggcatgaagggcgagttaaaaata
tctgattttggttggtctgtacatgctccttcatcaaggcgtacaactctttgtggtacc
ttagactatttaccacctgaaatgattgagggaaaagttcatgatgaaaaagttgactta
tggagtgttggtgttttatgttatgaatttttagttggaaaaccaccttttgagacagaa
agccatgaccatacgtatcagctgatttcttctgtcaaatactcatttccagactatgta
agttctggcgcccgcgatcttatatcccagctacttcgcaagaaaccatcagatagacta
ccgttagcagatgtcctaaagcatccatggatccaacaacattcttctatgtttaataaa
caaaaggtttcagtgaaccagacacctacaacttcagtctcgtctctttctagttcctga

DBGET integrated database retrieval system