KEGG   Hydra vulgaris: 100200477Help
Entry
100200477         CDS       T01080                                 

Definition
(RefSeq) aurora kinase C
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100200477
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100200477
Protein phosphatases and associated proteins [BR:hmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100200477
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100200477
   Spindle formation proteins
    100200477
  Sister chromatid separation proteins
   Aurora kinases
    100200477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 339 aa AA seqDB search
MNALKDNNFQNSSKGTVKTMLQKSDKPSSLEKENQDQKEPKNQNKENPPPPIDKCWSLSD
FDIGKPLGKGKFGSVYLAREKQSHFIVALKVLFKSQLMKAAVEHQLRREIEIQSHLKHPH
ILRLYGYFYDAKRVFLILEYAPQGELYKHLTKSERFNEAKSATYISQLASALEYCHSKKV
IHRDIKPENLLLGMKGELKISDFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKVHDEKVDL
WSVGVLCYEFLVGKPPFETESHDHTYQLISSVKYSFPDYVSSGARDLISQLLRKKPSDRL
PLADVLKHPWIQQHSSMFNKQKVSVNQTPTTSVSSLSSS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattaaaagataataattttcagaattcgtctaaaggaactgtaaaaacaatg
cttcaaaaatctgacaaaccaagtagtttagaaaaagaaaatcaagatcaaaaagaaccc
aaaaatcaaaataaagaaaatcctcctccgcctattgataaatgttggtctctatctgat
tttgatattggcaaaccacttggaaaaggtaaatttggaagtgtctaccttgcaagagaa
aaacagagtcattttattgttgcattaaaagtcttgtttaaatcacaacttatgaaagca
gctgttgagcatcaattgagaagagaaattgaaatacaatcacacttaaaacatccacac
atattaagattatatggctacttctatgatgcgaagcgcgtgtttcttatactggagtat
gcaccacaaggagagttatataaacatctaacaaaatcagaacgttttaatgaggccaag
tcagcaacatatatttcccagttggcttcagctcttgaatattgtcattcgaagaaagta
atccatagagatattaagccagaaaatcttttacttggcatgaagggcgagttaaaaata
tctgattttggttggtctgtacatgctccttcatcaaggcgtacaactctttgtggtacc
ttagactatttaccacctgaaatgattgagggaaaagttcatgatgaaaaagttgactta
tggagtgttggtgttttatgttatgaatttttagttggaaaaccaccttttgagacagaa
agccatgaccatacgtatcagctgatttcttctgtcaaatactcatttccagactatgta
agttctggcgcccgcgatcttatatcccagctacttcgcaagaaaccatcagatagacta
ccgttagcagatgtcctaaagcatccatggatccaacaacattcttctatgtttaataaa
caaaaggtttcagtgaaccagacacctacaacttcagtctcgtctctttctagttcctga

DBGET integrated database retrieval system