KEGG   Hydra vulgaris: 100200477Help
Entry
100200477         CDS       T01080                                 

Definition
aurora kinase A-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 419 aa AA seqDB search
MDTINTSKINTLRLSNLESSNSMLFGQKSVSRFSSQQALVQRGKSGLTGLLVGLEKDLQS
ISRRFASFSASNELTLETRVETSDYNFPHQNSSKGTVKTMLQKSDKPSSLEKENQDQKEP
KNQNKENPPPPIDKCWSLSDFDIGKPLGKGKFGSVYLAREKQSHFIVALKVLFKSQLMKA
AVEHQLRREIEIQSHLKHPHILRLYGYFYDAKRVFLILEYAPQGELYKHLTKSERFNEAK
SATYISQLASALEYCHSKKVIHRDIKPENLLLGMKGELKISDFGWSVHAPSSRRTTLCGT
LDYLPPEMIEGKVHDEKVDLWSVGVLCYEFLVGKPPFETESHDHTYQLISSVKYSFPDYV
SSGARDLISQLLRKKPSDRLPLADVLKHPWIQQHSSMFNKQKVSVNQTPTTSVSSLSSS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataccatcaatactagtaagatcaatactttaagattatctaacttagaaagtagt
aattcaatgttatttggacaaaaaagtgtttcaagatttagttcgcaacaggctttagta
caaagaggaaagtctggattaactgggttattggttggtttagagaaggatttacaatca
atttcaagacgttttgcatcattttctgcttctaatgaactaactcttgaaacaagagtt
gaaaccagtgattataattttccacatcaaaattcgtctaaaggaactgtaaaaacaatg
cttcaaaaatctgacaaaccaagtagtttagaaaaagaaaatcaagatcaaaaagaaccc
aaaaatcaaaataaagaaaatcctcctccgcctattgataaatgttggtctctatctgat
tttgatattggcaaaccacttggaaaaggtaaatttggaagtgtctaccttgcaagagaa
aaacagagtcattttattgttgcattaaaagtcttgtttaaatcacaacttatgaaagca
gctgttgagcatcaattgagaagagaaattgaaatacaatcacacttaaaacatccacac
atattaagattatatggctacttctatgatgcgaagcgcgtgtttcttatactggagtat
gcaccacaaggagagttatataaacatctaacaaaatcagaacgttttaatgaggccaag
tcagcaacatatatttcccagttggcttcagctcttgaatattgtcattcgaagaaagta
atccatagagatattaagccagaaaatcttttacttggcatgaagggcgagttaaaaata
tctgattttggttggtctgtacatgctccttcatcaaggcgtacaactctttgtggtacc
ttagactatttaccacctgaaatgattgagggaaaagttcatgatgaaaaagttgactta
tggagtgttggtgttttatgttatgaatttttagttggaaaaccaccttttgagacagaa
agccatgaccatacgtatcagctgatttcttctgtcaaatactcatttccagactatgta
agttctggcgcccgcgatcttatatcccagctacttcgcaagaaaccatcagatagacta
ccgttagcagatgtcctaaagcatccatggatccaacaacattcttctatgtttaataaa
caaaaggtttcagtgaaccagacacctacaacttcagtctcgtctctttctagttcctga

DBGET integrated database retrieval system