KEGG   Hydra vulgaris: 100200484Help
Entry
100200484         CDS       T01080                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II-like
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hmg  Hydra vulgaris
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100200484
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100200484
   04070 Phosphatidylinositol signaling system
    100200484
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100200484
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100200484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 953 aa AA seqDB search
MAGAGPISETLPVVSVPSMLVDGGRFLKWDDQDLACSIYILEVDQLGHVLSWKPEDFSKD
TEVLDLVHVRDVRTGQYAKVPKPQDIRARDAIKMYSAFEHESNLMQERTITIVYGSNFVD
LTFINFVASSVSEAQEWTDALFKCTNNLLEFNSSPLKCLERFFTRIYVQKNQEGEIPTKI
LVKAFVNNKEDKKRAYGTLQSVGIASGKKETILVKDFTFERFLAFYNRFVTRHDLDGVFA
ELGAKNKPYLTTDQLVDFLNNRQRDPRLNEILFPYYDISGAQAIVNTYEPNKAFADKGYI
SIDGLTKFLMSSDANILLPGKLQIHQDLTFPVAHYFINSSHNTYLQGHQLTGKSSVEIYR
QVLLAGCRCIELDCWDGRTEEQEPVITHGMTLCTEVPFKDVIEAIKESAFKTSEYPVILS
FENHCSAKQQKKMASYCLQIFGDLLLNKELEECPLLPGVPLPSPKMLKRKILIKNKKRDI
KVPVSETKNSNLFAQSIDLNISGVMLEISNMEDIPEDGELKEVVPKSEEEETPEVEAQQE
LSELVNYFQPVHFRGFERAEKVKRYYEMSSFSENAAMNLLKEQPVEFVNYNKFQASRIYP
KGSRVSSDNYIPQLFWNAGCQLVALNFQTLDVPMQLNLGKFEINGRCGYLLKPEHMRRHD
RTFDPFVESTVDGIIAGTVQVRVISGQCLLERRSGTYVEVEMYGLPADTVRRKYRTKVVS
NNGLNPVYDEEPFKFKVILPHLAELRISVYEENGKMIGHRVLPVDGLSPGYRHIKLRNES
YQPLCLPTLFVDIVTKDYVPESFSDFADALSNPMKYLSEKEKRTQQLEAFEFEESDSTVA
TSTPEFLAPELQNISAIKRGSIVSLQTIINQDKRDKRDPGKIEIKKNQNDSLGNRTQSEV
FGKPESPVETLKRTFSTPSSQDNHIRHDILKISAPSIDTLKEHKVCFQDIIFP
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcaggcccaatttcggaaactcttcctgttgtttcagttccctccatgctt
gtagatggaggtagatttcttaaatgggacgatcaagacctcgcatgctctatctatatt
ctggaagttgatcaacttggtcatgtattgagttggaagccggaagatttttcaaaggac
actgaagtactggatttggttcatgttagagatgtgagaactgggcagtacgcaaaggtt
ccaaaaccacaggatatacgtgctcgagatgcaattaaaatgtacagtgcttttgagcat
gagagtaatttaatgcaagaacgtaccataacaattgtttatggaagcaattttgtggac
cttacattcattaattttgttgcatctagtgtttcagaagcgcaagaatggactgatgca
ttattcaaatgcacaaacaatcttcttgaatttaattcaagtcctttgaagtgcttagag
agattttttacaagaatatatgtccagaaaaatcaggaaggagaaattccaacaaaaatt
ttagttaaagcttttgtgaacaataaagaagataaaaaaagagcttatggtactctgcaa
tctgtaggaattgcatctggaaagaaagaaacaatacttgttaaagatttcacttttgag
aggtttttagcattttataatcgatttgtaacaaggcatgacttagatggcgtctttgct
gaattaggagctaaaaataagccttatctgaccacagatcaactagtagattttcttaat
aaccgacagcgtgatcctaggctcaatgaaatactttttccttattatgatataagtggg
gcacaagccattgttaatacttacgaaccaaacaaggcatttgcggataaaggttatatt
tctattgatggtctcacaaagtttttaatgagtagcgatgctaatattcttttacctgga
aagttgcaaattcatcaagatcttacttttcctgttgcccattactttattaattcttcc
cataacacatatttgcaaggccaccagttaacaggaaaatcttcagttgaaatatacaga
caagttttgctagctggatgtcgttgcattgagttagattgctgggacgggcgcacggaa
gagcaagagccagttattactcatggaatgacattatgtactgaggtcccatttaaggat
gtgattgaagcgattaaagaatcagcatttaaaacttctgaatatccagtcatattgtct
ttcgaaaatcattgcagtgccaagcaacaaaagaaaatggcaagttattgccttcaaatc
tttggagatcttctacttaataaagaattggaagaatgtccactgttaccaggagttcct
ttaccaagtccaaaaatgctgaaaagaaaaatcttgataaaaaataaaaagcgtgacatt
aaagtaccagtgtccgaaacaaaaaactctaacttatttgctcaatcaattgatttaaac
ataagtggtgttatgcttgaaatttctaatatggaagacatacctgaagatggagagtta
aaggaagtggttcctaagtctgaagaagaagagacacctgaagttgaagctcaacaagag
ttatctgaacttgtaaattattttcaacctgttcactttagaggatttgaaagggctgaa
aaagtaaaacgttattatgagatgtcatcgtttagtgaaaatgctgctatgaatctgctc
aaggagcaacctgtagaatttgtcaattataacaaatttcaagcaagcagaatttatcca
aaaggtagtcgtgtgagctcagacaattatattccgcaattattttggaatgctggatgc
caattggttgcattaaactttcaaaccttagatgttcctatgcagctaaatcttggtaaa
tttgaaataaatggacgctgtgggtatcttttaaagcctgaacacatgaggcgacatgat
cgtacatttgatccattcgttgaatctacagtagatggtataattgctggtactgttcaa
gttagggttatttctggccagtgtttattagaaagaagatctggaacttatgttgaggtt
gaaatgtatggattacctgctgatactgttcgaagaaaatatcggaccaaagttgtttca
aacaatggattgaatccagtttatgatgaagaaccttttaaatttaaggtaattttacct
catcttgctgaattgcgaatatcagtgtatgaagaaaatggaaaaatgattggtcacaga
gtattacctgtggatggtttgtcaccaggttatcgccatattaagttgagaaatgaatct
tatcaaccattgtgtcttccaacattatttgttgatattgttaccaaagactacgtgcct
gaaagtttttcagattttgctgatgctctatcaaatccaatgaaatatttgtcagagaaa
gagaagcgtactcaacagttagaagcatttgaatttgaagaatctgattcaacagttgcc
acaagtactccagagtttttagcaccagagctccaaaatatatcagcaataaaaagagga
agtatagtttcattgcaaactatcattaatcaagataaaagagataagcgtgatcctggt
aaaatagaaattaaaaaaaaccaaaatgacagtctcggaaatcgcactcaatctgaagtg
tttggaaaacctgaatctcccgtagaaacactaaaacgaacttttagcactcctagctca
caagataatcacatacgtcatgatattctaaaaattagtgctccatcaattgatactctc
aaagaacacaaagtatgttttcaagatattatttttccttaa

DBGET integrated database retrieval system