KEGG   Hydra vulgaris: 100200492Help
Entry
100200492         CDS       T01080                                 

Definition
glutathione peroxidase 1-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hmg  Hydra vulgaris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100200492
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100200492
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100200492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 203 aa AA seqDB search
MNELQEKYGPLYAKTYHPHKPNCHIQFIGFPCNQFGHQEPAENFELMNTLKYVRPGYGFV
PNFPLSGKLHVNGAYEHPIFTFLKNRCESPMGLIANRSDITWTPIRNNDISWNFQKWLIS
SDGHPYKRYTSRTTPAMIENDIKMLIDQCVQGNNQVSRTNQDTVLPGPLPQPQAQIPAGS
PGPIPEPESNKFQKRYVHDGLSY
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattacaagaaaaatacggtcctctatatgcaaaaacttaccatccacataag
ccaaattgtcatattcagtttataggatttccatgcaatcagttcgggcaccaggaacct
gctgaaaactttgagcttatgaatactttaaagtatgtgcgcccaggatatggatttgtt
ccaaatttccctctttcaggaaaactgcatgttaatggcgcctatgaacacccaatattt
acatttttaaagaatcgttgcgagtctccaatgggattaattgctaatcgctcagatata
acatggaccccaattcgtaacaatgacatctcgtggaactttcaaaaatggctgatttcg
tcagatggccacccatataaaagatacacatctcgtacaactcctgcaatgattgaaaat
gatattaaaatgcttattgaccagtgcgtccaaggcaataatcaggtgtcaagaacaaat
caagatacagtacttcccggtccattacctcaaccccaggcacaaataccagctggtagc
ccaggtcccatacctgagccagaatcaaataaatttcaaaaacgctatgtccatgatggg
ttatcgtattaa

DBGET integrated database retrieval system