KEGG   Hydra vulgaris: 100200492Help
Entry
100200492         CDS       T01080                                 

Definition
glutathione peroxidase 1-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hmg  Hydra vulgaris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hmg00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:hmg00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 203 aa AA seqDB search
MNELQEKYGPLYAKTYHPHKPNCHIQFIGFPCNQFGHQEPAENFELMNTLKYVRPGYGFV
PNFPLSGKLHVNGAYEHPIFTFLKNRCESPMGLIANRSDITWTPIRNNDISWNFQKWLIS
SDGHPYKRYTSRTTPAMIENDIKMLIDQCVQGNNQVSRTNQDTVLPGPLPQPQAQIPAGS
PGPIPEPESNKFQKRYVHDGLSY
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattacaagaaaaatacggtcctctatatgcaaaaacttaccatccacataag
ccaaattgtcatattcagtttataggatttccatgcaatcagttcgggcaccaggaacct
gctgaaaactttgagcttatgaatactttaaagtatgtgcgcccaggatatggatttgtt
ccaaatttccctctttcaggaaaactgcatgttaatggcgcctatgaacacccaatattt
acatttttaaagaatcgttgcgagtctccaatgggattaattgctaatcgctcagatata
acatggaccccaattcgtaacaatgacatctcgtggaactttcaaaaatggctgatttcg
tcagatggccacccatataaaagatacacatctcgtacaactcctgcaatgattgaaaat
gatattaaaatgcttattgaccagtgcgtccaaggcaataatcaggtgtcaagaacaaat
caagatacagtacttcccggtccattacctcaaccccaggcacaaataccagctggtagc
ccaggtcccatacctgagccagaatcaaataaatttcaaaaacgctatgtccatgatggg
ttatcgtattaa

DBGET integrated database retrieval system