KEGG   Hydra vulgaris: 100200741Help
Entry
100200741         CDS       T01080                                 

Definition
profilin-like
Orthology
K05759  
profilin
Organism
hmg  Hydra vulgaris
Brite
Exosome [BR:hmg04147]
 Exosomal proteins
  Proteins found in most exosomes
   100200741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 139 aa AA seqDB search
MSWDSYLDNLCAQSNDSTGKAHCGKAAIISLDGGASWTSPNHPHGIQLTPAEGQKIAQMM
KSGDFSSAQANGIIMEGVKYQFLREDGKVAFAKKKDHGAITIQKSKSAVVIGHTSEGCQQ
GNTNKAVGVIADYLESVGM
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggactcttatcttgataatctctgtgcacaatcaaatgattcaactggcaaa
gcgcactgtggtaaagctgctataatatctttagatggaggtgcatcatggacttctcca
aatcatcctcatggtattcaattaacacctgctgagggacagaagatagcccaaatgatg
aagtctggtgatttctcatctgcccaagcaaatggtattattatggaaggtgttaaatat
caatttctcagagaagatggaaaagtagcttttgctaaaaagaaagatcatggagctata
acaattcaaaaaagtaaatcagctgtagttattggacatacatcagaaggttgccagcaa
ggtaatacaaacaaggctgttggtgtaattgctgattatcttgagagtgtaggaatgtaa

DBGET integrated database retrieval system