KEGG   Hydra vulgaris: 100200777Help
Entry
100200777         CDS       T01080                                 

Definition
serine/threonine-protein kinase minibrain-like
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100200777
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100200777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 647 aa AA seqDB search
MLTYNDGDSSSSSGSSTVDEKLPYPPPATNPESSYDYYVRKIPTVFRDNQEAPLRKLSTD
LIKCYKHINEVYYAKKKRRADKEKAEGELLKKGKHNEGFDDENYDYIVRSGEKFIDRFEI
DSLIGKGSFGQVVKAYDHDEQQFVAIKIIKNKKPFLNQAQIEVKILELMNSNDPQSKYYI
VKLKSHFMWRNHLCLVFELLSYNLYDLLRNTNFHGVSLNLTRKFAQQLCTALCFLSTPDL
QVIHCDLKPENVLLCNPKRSAIKIVDFGSSCQLGQTLYHYIQSRFYRSPEVLLGLPYDLA
IDMWSLGCILVEMHTGEPLFSGADEIDQMNKIVEVLGIPPTKLLDKASKTKKYFERLPDG
SYQVRRYKDSKKEYIENGSRKLHDILGCDIGGPEGRRKNESGHSPQDYMKFKDIVLKMLE
YDPKTRISPYQALQHPFFKRNSEESNMNYSTSVSPVHQKDEKEYINVAHTVRTNPAVIHR
PSSDPTGFRNSAMDCEGEVPHQTRVVDIKLRHNVKMQTDPLPVKTVSPEPEERTKINDKL
KIDNPLSFPKHSVDILQSEQLSSSFRYSLLTNGIYPFSSGNAIPYESKSEFIDTLTNLSH
YKESAYSSYLTNEAVLSPGLLHTSRKDFIAPEDPRLRSVILHGDVHR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcttacatataatgatggtgatagtagcagttcatctgggagctccacagttgatgaa
aagcttccatacccaccgcctgcaactaatcccgaatcatcatatgattactatgttaga
aaaatccctacagtatttagggacaaccaagaagccccattaagaaaactttctacagat
cttattaagtgctataaacatataaatgaggtttattacgcaaaaaaaaaaaggcgtgct
gataaggagaaagcagaaggggagttactaaaaaagggaaaacataatgaaggatttgac
gatgagaattatgactatatcgttcgtagtggcgaaaaatttattgatcgttttgaaatt
gattcattgattggaaaaggatcatttggacaggttgttaaagcgtacgaccacgatgaa
caacaattcgttgctatcaagattatcaaaaataaaaaaccgtttttaaatcaagcccaa
atcgaagttaagattttagagctcatgaacagcaacgatccgcaatcaaaatattatata
gtgaaattgaaatcgcattttatgtggcgaaatcatttatgcttggtatttgaacttctt
tcttataacctttatgatcttttacgaaacacgaattttcatggtgtatcgcttaacctt
actcgaaagtttgcgcaacaactatgtactgcgttgtgttttctttcaacgccagatctg
caagttattcattgtgacttaaaacctgaaaatgttcttctttgtaatccaaaacgtagt
gctataaaaatcgtcgattttggaagttcctgtcaacttggtcaaacgctttatcattac
attcaaagtagattttaccgttcacctgaagttttgttagggcttccatacgatttagca
attgatatgtggtcgctaggttgcattttggtagaaatgcacacgggggagcccttattt
agtggggcagatgaaattgatcaaatgaacaaaattgtagaagttcttggaattcctccc
acgaaattactagacaaggcttcaaaaacaaaaaaatattttgagcgtctacctgatgga
agttaccaagttcgccgttataaagatagtaaaaaagaatacattgaaaatggtagtcgt
aagttgcatgacatactcggctgtgatattggtggaccagaagggcgtagaaaaaacgaa
tcgggtcattctcctcaggattatatgaaattcaaagatattgttttaaaaatgcttgaa
tacgatccaaagacacggataagtccttaccaagcccttcagcatcctttttttaaacgc
aactctgaggaatccaatatgaactattcaacgtcagtatctcctgtacatcaaaaagat
gaaaaggagtacataaacgttgcgcacacagttagaacgaaccctgcagttatacataga
ccttcctctgatcctacgggttttcgaaattcagctatggattgcgaaggggaagttccc
catcaaactcgcgttgtagatataaaattgcgtcataatgtaaagatgcaaaccgatccg
ttacctgtaaaaactgtcagtccagaaccagaagagaggacaaaaataaatgataaatta
aagatagataatccgctatcttttccaaaacattcagttgacattttacaatccgaacaa
ttgagtagttcgtttcgttacagcttgttgacgaacggtatctacccttttagttcgggt
aacgccattccttacgaatcaaaatccgagtttatcgatactctaactaatttaagtcat
tataaagagtctgcgtatagtagctacctcacaaatgaagctgttttatctccaggcctg
ttacatacaagccgaaaggattttatcgcgccggaagatccaagacttcgtagcgtaatt
cttcatggcgatgttcatcgatag

DBGET integrated database retrieval system