KEGG   Hydra vulgaris: 100200909Help
Entry
100200909         CDS       T01080                                 

Definition
dual specificity mitogen-activated protein kinase kinase 2-like
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 353 aa AA seqDB search
MCLNFNQKENVKPSVAVAPPQHQHCSHNVVHLLQSSSGTLTIKDEIYQYTALDLIDLGEI
GRGNFGTVNKMRHRESKTEMAVKRIRATIDKDEQRHLLKELDIIMNTTDCIYIVQFYGAI
FIEGDCWICMELMTTSVEKTYKAVHKVLMQKVPEEIIGKIAYCVIKALDYLKTNLEIIHR
DVKPSNILVDKEGQIKLCDFGISGQLVDSIARTRDAGCQPYMAPERIDPSQARSGYDVRS
DVWSLGMSLIEIAIGKFPYPKWTTIFDQLSQVIDGDPPKLVNTEQQIFSKNCLDCINSCM
AKDFKLRPKYNELLRNPFIISYEKNNNIKEWFNNVLTKVPNLPSLVTDSETHD
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttaaattttaatcaaaaagaaaatgtgaaaccaagtgtggcagttgcaccgcca
caacatcagcattgttcgcataatgtagttcatcttttacaaagttcatctgggacttta
actattaaagatgagatataccagtatactgctttagatttgattgaccttggtgaaata
ggtcgtggtaattttggcactgtgaacaagatgagacacagagaaagtaaaacagaaatg
gcagtaaagaggattcgtgcgacaatagataaagatgaacaaagacatttgttaaaagaa
cttgatattattatgaataccactgattgtatatatattgttcagttttatggcgcaata
tttattgagggtgattgttggatatgtatggagttaatgacgacatctgtagagaaaact
tacaaagcagttcataaagtcttgatgcagaaagtaccagaagagatcataggaaaaata
gcttactgtgtcataaaggcattagattatttgaaaacaaatttagaaatcatacataga
gatgtaaaaccttcaaatatattggttgataaagaaggccaaattaaactttgtgatttt
ggtattagtggtcaacttgttgattcaattgcaagaacaagggatgcagggtgtcagcca
tatatggctcctgaaagaattgacccatcacaagcaagaagtggttatgatgttcgctca
gatgtttggtctcttggaatgtcattaattgaaattgctattggaaagtttccttaccca
aaatggacaacaatctttgatcagttgtcacaagtaattgatggtgaccctccaaaactg
gttaatacagaacagcagattttttctaagaattgtcttgattgtatcaatagctgtatg
gcaaaagatttcaagttgcgtccaaaatataatgagttactgcgtaatccctttatcata
agctatgaaaaaaacaataatatcaaagagtggtttaacaacgtgttaactaaagttccc
aatcttccttctcttgttaccgattctgaaacgcatgattag

DBGET integrated database retrieval system