KEGG   Hydra vulgaris: 100201254Help
Entry
100201254         CDS       T01080                                 

Gene name
usp7
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 7
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100201254 (usp7)
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100201254 (usp7)
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100201254 (usp7)
Ubiquitin system [BR:hmg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100201254 (usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 491 aa AA seqDB search
MKEKDEEGKESTQLVGTDEPAKENHLNENIKDVEMADEDHCRAEGLITFEVHNVSKIKET
VLSEPVIIRNLPWRIMLMPRYSVNQSNERSKSAGVFVQCDPDSDVASWSCQAHAKITLKS
HKGEDVVRKISHLFFAKENDWGYSTFVPWNDLIDVHKGYCKNDIITLEAFVQAEAPHGVF
WDSKKLTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYQMPTENDDINKSVALALQRVF
YDLQHSDKPVATKKLTKSFGWETLDSFMQHDAQELCRVGIIPKLLEGKMNSYIQCSNVDY
YSSREEPFYDIQLNIKGKTDVIDSFTEYIKAEMLDGDNKYDAGQHGLQDAKKGVIFRHFP
PVLHLHLLRFQYDPQTDTNYKINDRYAFPESLNLEKFLEPEFRANAPAPIYTLHAVLVHS
GDNHGGHYVVYINPRGDGKWFKFDDDVVSQATKKEAIENNFGGFEDEVVLRHCTNAYMLS
YLRTSDLSEFF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagacgaagaaggtaaagaaagcactcaattagttggtactgatgaacct
gctaaagaaaatcatttaaatgaaaatataaaagatgtggaaatggcagatgaagatcac
tgtagagcagaaggtctaattacatttgaagttcacaatgttagtaaaatcaaggaaact
gtacttagtgagcctgtaataattcgaaatttaccttggagaatcatgcttatgcctcga
tacagtgtaaatcaaagtaatgaacgttcaaaaagtgctggtgtttttgttcaatgtgat
cctgatagtgacgttgcatcatggtcttgtcaagctcatgccaagataaccctaaaatca
cacaaaggagaggatgtagttagaaaaatatcacatttattttttgcaaaagaaaatgat
tgggggtatagcacatttgttccatggaatgatctgattgatgttcataaaggttactgt
aaaaatgatatcattaccctagaagcatttgttcaagcagaagcacctcatggtgttttt
tgggattcaaaaaagcttactggctatgttggtttgaaaaatcaaggtgcaacttgctac
atgaactcactcctgcagactttatttttcacaaatcaattacgaaaggctgtttaccaa
atgcctaccgaaaatgatgatataaataaaagtgttgcacttgcattacaaagagttttt
tatgatctccaacacagtgacaaacctgttgctaccaaaaagcttactaagtcgtttggt
tgggaaaccttagatagttttatgcaacatgacgctcaagagttatgtagagtgggcatc
atacctaagcttttggagggaaaaatgaattcttatattcaatgctctaatgttgactac
tattcttcaagggaagagccattttatgatattcaacttaatattaaaggaaaaacagat
gttattgattcattcacagaatatataaaagcagaaatgcttgatggagataataaatat
gatgcaggccaacatggattacaggatgctaaaaagggtgttatatttcgacattttcca
cctgttttacatttacacttattgcgatttcaatatgatcctcaaacagacactaactat
aaaattaatgatagatatgcttttccggaatctttaaatcttgaaaaatttcttgaacca
gagtttcgagcaaatgcaccagctccaatatacacattacatgctgtactagtgcatagt
ggtgataatcatggtggtcattatgttgtctatattaatccccgtggtgatggaaagtgg
ttcaaatttgatgatgatgttgtttcacaagcaacaaaaaaagaagccattgaaaataat
tttggtggttttgaggatgaggtggtacttcgccattgtacaaatgcttatatgttatct
tacttgagaacatctgacttaagtgagtttttttaa

DBGET integrated database retrieval system