KEGG   Hydra vulgaris: 100201254Help
Entry
100201254         CDS       T01080                                 

Gene name
usp7
Definition
ubiquitin carboxyl-terminal hydrolase 7
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100201254 (usp7)
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100201254 (usp7)
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100201254 (usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 633 aa AA seqDB search
MKEKDEEGKESTQLVGTDEPAKENHLNENIKDVEMADEDHCRAEGLITFEVHNVSKIKET
VLSEPVIIRNLPWRIMLMPRYSVNQSNERSKSAGVFVQCDPDSDVASWSCQAHAKITLKS
HKGEDVVRSNRFXTQKISHLFFAKENDWGYSTFVPWNDLIDVHKGYCKNDIITLEAFVQA
EAPHGVFWDSKKLTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYQMPTENDDINKSVA
LALQRVFYDLQHSDKPVATKKLTKSFGWETLDSFMQHDAQELCRVGIIPKLLEGKMNSYI
QCSNVDYYSSREEPFYDIQLNIKGKTDVIDSFTEYIKAEMLDGDNKYDAGQHGLQDAKKG
VIFRHFPPVLHLHLLRFQYDPQTDTNYKINDRYAFPESLNLEKFLEPEFRANAPAPIYTL
HAVLVHSGDNHGGHYVVYINPRGDGKWFKFDDDVVSQATKKEAIENNFGGFEDEVVLRHC
TNAYMLSYLRTSDLKKKNQSPLEGIMSKMAIWNDIEIRINTKVPRGICDSCRTTLRRKDE
RKDVALPLFLTSLQCFKPEEDNTPQRCGDCLSLVGRGLPHQCTQFKFRENLKQLATADPS
AAVKIATQVISSKPSTPGGTVKILQPKGSTSQS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagacgaagaaggtaaagaaagcactcaattagttggtactgatgaacct
gctaaagaaaatcatttaaatgaaaatataaaagatgtggaaatggcagatgaagatcac
tgtagagcagaaggtctaattacatttgaagttcacaatgttagtaaaatcaaggaaact
gtacttagtgagcctgtaataattcgaaatttaccttggagaatcatgcttatgcctcga
tacagtgtaaatcaaagtaatgaacgttcaaaaagtgctggtgtttttgttcaatgtgat
cctgatagtgacgttgcatcatggtcttgtcaagctcatgccaagataaccctaaaatca
cacaaaggagaggatgtagttagaagtaatagattttaaacacaaaaaatatcacattta
ttttttgcaaaagaaaatgattgggggtatagcacatttgttccatggaatgatctgatt
gatgttcataaaggttactgtaaaaatgatatcattaccctagaagcatttgttcaagca
gaagcacctcatggtgttttttgggattcaaaaaagcttactggctatgttggtttgaaa
aatcaaggtgcaacttgctacatgaactcactcctgcagactttatttttcacaaatcaa
ttacgaaaggctgtttaccaaatgcctaccgaaaatgatgatataaataaaagtgttgca
cttgcattacaaagagttttttatgatctccaacacagtgacaaacctgttgctaccaaa
aagcttactaagtcgtttggttgggaaaccttagatagttttatgcaacatgacgctcaa
gagttatgtagagtgggcatcatacctaagcttttggagggaaaaatgaattcttatatt
caatgctctaatgttgactactattcttcaagggaagagccattttatgatattcaactt
aatattaaaggaaaaacagatgttattgattcattcacagaatatataaaagcagaaatg
cttgatggagataataaatatgatgcaggccaacatggattacaggatgctaaaaagggt
gttatatttcgacattttccacctgttttacatttacacttattgcgatttcaatatgat
cctcaaacagacactaactataaaattaatgatagatatgcttttccggaatctttaaat
cttgaaaaatttcttgaaccagagtttcgagcaaatgcaccagctccaatatacacatta
catgctgtactagtgcatagtggtgataatcatggtggtcattatgttgtctatattaat
ccccgtggtgatggaaagtggttcaaatttgatgatgatgttgtttcacaagcaacaaaa
aaagaagccattgaaaataattttggtggttttgaggatgaggtggtacttcgccattgt
acaaatgcttatatgttatcttacttgagaacatctgacttaaaaaaaaaaaatcaaagt
cctttagaaggaataatgtcgaaaatggctatatggaatgatatcgaaattcggatcaat
accaaagtgccaagaggtatctgtgactcttgtcgaacaactcttagaagaaaagatgaa
agaaaagatgttgctcttccactttttttgacttctcttcagtgcttcaaacctgaggaa
gacaatactccccaacgatgtggtgattgcttgagtcttgttggaagaggtctgccacat
cagtgcactcaattcaaatttagagagaatctaaaacagttagctacagcagatccatcg
gctgcagtaaaaattgcaactcaagtaatctcttccaaaccttcaactccaggaggtact
gttaaaattttacaaccaaaagggtcaacctctcagagttag

DBGET integrated database retrieval system