KEGG   Hydra vulgaris: 100201400Help
Entry
100201400         CDS       T01080                                 

Definition
stress-activated protein kinase JNK-like
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100201400
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100201400
   04068 FoxO signaling pathway
    100201400
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100201400
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100201400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 356 aa AA seqDB search
MFYSVQIGDTIFTILNRYQNLHPIGSGAQGMVCCAAYDTVIKQKVAIKKLSRPFQNVTHA
KRAFRELKLMKITNHKNIIGLLNVFTPDKSLEDFMDLYLVMELMDASLCQVVQMDLDHER
LSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFTMTPYVV
TRYYRAPEIILGMGYSENVDVWSIGCIFGEMIRGSVMFPGTDHIDQWNKVTELLSTPPQS
FFDRLQPSVRMYCANRPKQKGYTIDELFPEDLFPVGNKQKVNQARDLLLKMLVVDPMKRI
TITQALNHPYVHVWYDAEEVEAPAPMQYDHKIDEIDHTVEEWKAEPREIISLICFV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttttactcagttcagataggggatactatatttactatcttaaatcgatatcaaaat
cttcaccctataggttctggtgctcaaggaatggtttgttgtgccgcatatgatacagta
ataaaacaaaaagttgctataaaaaagttaagtagaccttttcaaaatgtaactcatgca
aagagagcattccgcgagttgaaattgatgaaaattacaaaccataaaaatattattggg
ctgcttaatgtatttactcctgacaaaagcttagaagatttcatggatttatatttagtc
atggaactaatggatgcaagtttatgtcaagttgtacaaatggatcttgatcatgaacga
ttatcatacttactgtatcagatgttatgtggaatcaagcatcttcattcagcaggtatt
atacatagagatttaaaaccaagcaatattgtagtaaagtctgattgcagtttaaaaatt
ttagattttggtcttgctagaacggctggttccgcatttacaatgaccccttatgtagtt
acaagatattatagagcaccagaaattatattaggaatgggatactctgaaaacgtagat
gtctggtctataggttgtatattcggtgaaatgattcgtggatcagtaatgttccctgga
acagatcacattgatcaatggaacaaagtaacagaacttctttcgactccaccacaatct
ttttttgatcgtcttcaaccatcagtacgtatgtactgtgccaatcgaccaaagcaaaag
ggttacacaatagacgaattatttccagaagatttgtttccggtgggaaataaacagaaa
gtaaaccaagcacgtgatctacttctaaaaatgttagttgttgatcctatgaagcgtata
actataacccaagcactgaatcatccctacgttcatgtttggtatgatgctgaagaagta
gaagcaccagcgccaatgcaatacgatcataaaatagacgaaatagatcatactgttgaa
gagtggaaagctgaaccgagagaaataatttccttaatttgtttcgtataa

DBGET integrated database retrieval system