KEGG   Hydra vulgaris: 100201400Help
Entry
100201400         CDS       T01080                                 

Definition
(RefSeq) stress-activated protein kinase JNK-like
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis - multiple species
Wnt signaling pathway
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100201400
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100201400
   04068 FoxO signaling pathway
    100201400
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    100201400
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100201400
   04933 AGE-RAGE signaling pathway in diabetic complications
    100201400
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100201400
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100201400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 356 aa AA seqDB search
MFYSVQIGDTIFTILNRYQNLHPIGSGAQGMVCCAAYDTVIKQKVAIKKLSRPFQNVTHA
KRAFRELKLMKITNHKNIIGLLNVFTPDKSLEDFMDLYLVMELMDASLCQVVQMDLDHER
LSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFTMTPYVV
TRYYRAPEIILGMGYSENVDVWSIGCIFGEMIRGSVMFPGTDHIDQWNKVTELLSTPPQS
FFDRLQPSVRMYCANRPKQKGYTIDELFPEDLFPVGNKQKVNQARDLLLKMLVVDPMRRI
TITQALNHPYVHVWYDAEEVEAPAPMQYDHKIDEIDHTVEEWKAEPREIISLICFV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttttactcagttcagataggggatactatatttactatcttaaatcgatatcaaaat
cttcaccctataggttctggtgctcaaggaatggtttgttgtgccgcatatgatacagta
ataaaacaaaaagttgctataaaaaagttaagtagaccttttcaaaatgtaactcatgca
aagagagcattccgcgagttgaaattgatgaaaattacaaaccataaaaatattattggg
ctgcttaatgtatttactcctgacaaaagcttagaagatttcatggatttatatttagtc
atggaactaatggatgcaagtttatgtcaagttgtacaaatggatcttgatcatgaacga
ttatcatacttactgtatcagatgttatgtggaatcaagcatcttcattcagcaggtatt
atacatagagatttaaaaccaagcaatattgtagtaaagtctgattgcagtttaaaaatt
ttagattttggtcttgctagaacggctggttccgcatttacaatgaccccttatgtagtt
acaagatattatagagcaccagaaattatattaggaatgggatactctgaaaacgtagat
gtctggtctataggttgtatattcggtgaaatgattcgtggatcagtaatgttccctgga
acagatcacattgatcaatggaacaaagtaacagaacttctttcgactccaccacaatct
ttttttgatcgtcttcaaccatcagtacgtatgtactgtgccaatcgaccaaagcaaaag
ggttacacaatagacgaattatttccagaagatttgtttccggtgggaaataaacagaaa
gtaaaccaagcacgtgatctacttctaaaaatgttagttgttgatcctatgaggcgtata
actataacccaagcactgaatcatccctacgttcatgtttggtatgatgctgaagaagta
gaagcaccagcgccaatgcaatacgatcataaaatagacgaaatagatcatactgttgaa
gagtggaaagctgaaccgagagaaataatttccttaatttgtttcgtataa

DBGET integrated database retrieval system