KEGG   Hydra vulgaris: 100201400Help
Entry
100201400         CDS       T01080                                 

Definition
stress-activated protein kinase JNK-like
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hmg04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hmg04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hmg04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 356 aa AA seqDB search
MFYSVQIGDTIFTILNRYQNLHPIGSGAQGMVCCAAYDTVIKQKVAIKKLSRPFQNVTHA
KRAFRELKLMKITNHKNIIGLLNVFTPDKSLEDFMDLYLVMELMDASLCQVVQMDLDHER
LSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCSLKILDFGLARTAGSAFTMTPYVV
TRYYRAPEIILGMGYSENVDVWSIGCIFGEMIRGSVMFPGTDHIDQWNKVTELLSTPPQS
FFDRLQPSVRMYCANRPKQKGYTIDELFPEDLFPVGNKQKVNQARDLLLKMLVVDPMKRI
TITQALNHPYVHVWYDAEEVEAPAPMQYDHKIDEIDHTVEEWKAEPREIISLICFV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgttttactcagttcagataggggatactatatttactatcttaaatcgatatcaaaat
cttcaccctataggttctggtgctcaaggaatggtttgttgtgccgcatatgatacagta
ataaaacaaaaagttgctataaaaaagttaagtagaccttttcaaaatgtaactcatgca
aagagagcattccgcgagttgaaattgatgaaaattacaaaccataaaaatattattggg
ctgcttaatgtatttactcctgacaaaagcttagaagatttcatggatttatatttagtc
atggaactaatggatgcaagtttatgtcaagttgtacaaatggatcttgatcatgaacga
ttatcatacttactgtatcagatgttatgtggaatcaagcatcttcattcagcaggtatt
atacatagagatttaaaaccaagcaatattgtagtaaagtctgattgcagtttaaaaatt
ttagattttggtcttgctagaacggctggttccgcatttacaatgaccccttatgtagtt
acaagatattatagagcaccagaaattatattaggaatgggatactctgaaaacgtagat
gtctggtctataggttgtatattcggtgaaatgattcgtggatcagtaatgttccctgga
acagatcacattgatcaatggaacaaagtaacagaacttctttcgactccaccacaatct
ttttttgatcgtcttcaaccatcagtacgtatgtactgtgccaatcgaccaaagcaaaag
ggttacacaatagacgaattatttccagaagatttgtttccggtgggaaataaacagaaa
gtaaaccaagcacgtgatctacttctaaaaatgttagttgttgatcctatgaagcgtata
actataacccaagcactgaatcatccctacgttcatgtttggtatgatgctgaagaagta
gaagcaccagcgccaatgcaatacgatcataaaatagacgaaatagatcatactgttgaa
gagtggaaagctgaaccgagagaaataatttccttaatttgtttcgtataa

DBGET integrated database retrieval system