KEGG   Hydra vulgaris: 100201504Help
Entry
100201504         CDS       T01080                                 

Definition
uncharacterized LOC100201504
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100201504
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100201504
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100201504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 995 aa AA seqDB search
MDYMEYMDYMEYMDYMEYMDYMEYMDYMEYMDYMNIYGYHSDCKSYPQSTLLIDVRPVEE
YNEASICHQCMINVPENILKPGANVNTIEMKLNLFTPTCPVKILSDVLLKFEGGFQLFAV
LGGFKEWHLSYPALTTNPIYCKLPQNMTFNQDFLSLVKDLSYPELIFDKKKDETKIVDTS
SVANFMRPDQMHDKNNTEKENYIEVPVENQTRSKNVTNNSNSQISLYEIVPNSQKSEESK
THFDKKHSSLESPSLNLVSDKNLINNRDIKENVGKTIVDIKENINKTIVDIKENENNIIR
NNNMNGDNTIRNDNVNKDNTIRDNSSVERISDNDYINSYINKKDNFVPSIPTNLDKLVLT
QPVVGLTTSDKLPVNVISHISPPILPVSTNTSTQHLTNIQNLTLPDKPKVFLQPKFKANS
ENLAERGNPVPDVSPIATSYPVITVPSMISQINPSMGLLSPQVNAIPNVMVQSSLDLPKQ
GENNNSSNVPAAFVPKQFSTNSLPVQKPKCLATLGLPNGWEKAISHDTGRVYYKDHNTET
THWELPIEVQQQMLTKPVPQKESSVSKAFNDSFPVPNKVSHKDAESKMKRSLSSPNLNEA
STDQLPKLKSFPVIDRLSKPTEKKTVLVDRTTKPVSASRLEKLAPIYGSMGRVLTGLKNL
GNTCYMNSVIQCLACTLPLGKYFTTGMYEKHLNLCNTNAHPGELARELAFLIIVISAGEY
RSVSPIDFKIALGKFAPDFSGFKQQDAHELLMFFMDGLHEDVNKIVKKEIIKVKETDNLS
DEIAADIAWKDYKLNNDSVIVDLFQGQFRSTVTCLSCNKRSKTFDAFNCLQLPLPSNQST
TLENCIQTFTKAEKIGGNDSWKCSNCKRYREASKTIEIWKLPPVLIIQLKRFHFDGRWHN
KIQTTVNFPMQNFNMSKYIVAPQSIHTKYHLYAVINHYGSFESGHYTANCVNPYYEKWYN
FDDSIVKEIDVNSIKTNTAYLLFYTAVDFKEYIKR
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggattatatggaatatatggattatatggaatatatggattatatggaatatatggat
tatatggagtatatggattatatggaatatatggattatatgaatatatatggttatcat
tcagattgcaaaagttacccacagtctactttattaattgatgtaagaccagttgaggaa
tacaatgaagcaagtatttgccatcaatgcatgattaatgtgcctgagaatattttaaaa
cccggtgcaaatgttaatacaattgaaatgaagctaaatttgtttacaccaacatgtcct
gttaaaattctttcagatgttttgctcaagtttgagggtggttttcaattgtttgctgta
ttaggtggttttaaagaatggcatttatcttatccagcacttacaacaaatcctatatac
tgcaaacttcctcaaaatatgacctttaatcaagattttctcagccttgtaaaagatcta
tcatatccagagcttatttttgacaaaaaaaaagatgaaacaaaaatagttgacacatct
tctgtggctaattttatgagacctgatcagatgcatgacaaaaataatactgaaaaggaa
aattacattgaagtacctgttgaaaatcaaacaagaagtaaaaatgtaactaataatagt
aattcacagatatctttatatgaaatagttccaaatagccaaaaatctgaagagtctaaa
actcattttgacaaaaaacactcctcacttgaatccccttcattaaatttagtatctgat
aaaaatctaattaataatagagatataaaggagaatgtaggtaaaactattgtagatatt
aaagagaatataaataaaactattgtagatatcaaggaaaatgaaaacaatattattaga
aataataatatgaatggagataataccattagaaatgataatgtgaacaaagataatacc
atcagagataattcttcagttgaaagaatttcagataatgactatataaatagttatatt
aataaaaaagataattttgttcccagtataccaactaacttagataagttagtattgaca
caaccagttgttgggttaaccacatcagataaactccctgttaatgtcatatcccatata
tctcctccaatattgccagtatcaacaaacacttcaacccaacacctaactaacatccaa
aatttaacattaccagataaacctaaagttttcttacagccaaagtttaaagccaattct
gaaaatcttgctgaacgaggtaatcctgttcctgatgtttcacccatagctacatcatat
cctgtaattactgttccttccatgatttcacaaataaatccaagcatgggtcttttatct
cctcaagttaatgccatacctaacgtaatggttcaaagctccctggatttacctaaacag
ggtgaaaataataatagttcaaatgttccagctgcatttgttccaaagcagttttccacc
aattctcttccagttcaaaaacctaaatgccttgctaccttaggtttaccaaatggctgg
gaaaaagctattagccatgacactgggagagtttattataaagaccataatactgaaaca
acccactgggagttgcctatagaagttcaacaacaaatgttaacaaaaccagtaccacaa
aaagaatcaagtgtttcaaaagcatttaatgattcttttccagttccaaacaaagtctcc
cataaagatgcagaatcaaaaatgaaaagatctctctcttcgccaaatctaaatgaagct
agtactgatcaattaccaaaattgaaatcgtttcctgttatagatcgtttatcgaagcca
acagaaaaaaaaactgttttagttgatagaacaaccaaacctgtttcagcatcaagatta
gaaaaattggcaccaatttatgggagcatgggtcgagttttaactggattaaaaaatctc
ggcaacacttgttatatgaactctgtaattcaatgtcttgcatgcacattgccacttgga
aagtattttacaactggaatgtatgagaaacatctgaatttgtgcaacactaatgcacat
cctggagagctagcacgtgagttagctttccttattattgtcatatcagcaggagaatat
cggtctgtttcaccaattgacttcaaaattgctttgggtaagtttgcacctgattttagt
gggtttaaacagcaagatgctcatgaacttttgatgttttttatggatggacttcatgaa
gatgtaaacaaaattgtaaaaaaggaaataattaaagtgaaagaaactgataatttatca
gacgaaatagctgctgatattgcatggaaagattacaagctaaataatgattcagtgatt
gttgatctatttcagggtcaatttcgcagcacagtgacatgtttaagttgtaataaacgt
tcaaaaacttttgatgcttttaactgcttgcagctgccactgccaagtaatcagtctaca
actcttgagaattgtattcaaacatttacaaaagctgaaaaaattggtgggaatgatagt
tggaagtgttccaattgcaagagatatcgagaagcatctaagactattgaaatatggaaa
ttacctcctgttcttattatccaacttaaaaggtttcactttgatggtcgttggcataat
aaaattcaaactacagttaactttccaatgcaaaattttaatatgtccaaatatattgtc
gcgccacaatcaatacatactaagtatcatctttatgcagtgattaaccattatggaagt
tttgaatcaggtcattatactgcaaattgtgtaaatccttattacgaaaaatggtataat
tttgatgatagtattgttaaagagattgatgtaaattctataaagacgaatactgcatat
ctcttgttttacacagcagtagacttcaaagaatatataaaacgttga

DBGET integrated database retrieval system