KEGG   Hydra vulgaris: 100201667Help
Entry
100201667         CDS       T01080                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100201667
Peptidases [BR:hmg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100201667
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100201667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 326 aa AA seqDB search
MSSDATKKARSTFFSKWSLVFSKLMWSLWSVLTFLVFCYIAFSALVLYSKEVKMEIIYSH
RIRSPWFANLSSCKDFGLVKCEQVYLNGYAGKLGAWFISPASQQYITREAYILYLHGNMG
SRAMHHRVQFYKRLSKMGYHILAIDYRGFGDSEGSPSEEGLVEDSKIAYKWLNNRARGFA
IYVWGHSLGSAVAVQLSSWLNAERAQLNGVVLEAPFNNITDAIIQTPLALPLYQFLPNFE
SYLDDVKNVFLSTFWIQKVTSPTLILHDVSDSIININLARKLYAVAKANGSTNVRMIEFD
EQLDHCEVSSAKQFKKLFSDFVFHTS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggatgcaactaaaaaagcacgctctacttttttctcaaaatggagtcttgta
ttttccaagctcatgtggtctctttggtctgtacttacatttttggtgttttgttacatt
gcattttctgcattagttttatattcaaaagaagtaaaaatggaaattatttattcacat
agaattcgttctccttggtttgcaaatctatcatcatgcaaagactttgggctagtgaaa
tgtgagcaagtctaccttaatggatatgctggaaaacttggggcttggtttatttcaccc
gcatcacagcaatatatcactagagaagcttatattctctacttacatggaaatatgggt
tctagagcgatgcatcatcgagttcaattttataagcgtctttctaaaatgggttatcat
atcctggctatagattatagagggtttggtgattcagagggatcaccttcagaagaaggt
ttagttgaagacagtaaaattgcttataaatggctaaataatagagcaaggggatttgca
atatatgtatggggtcattcccttggtagcgcagttgctgttcagttatcatcatggctc
aatgctgaaagagcccaattaaatggtgttgttttagaagcaccttttaataatataaca
gatgctattatccaaacacctttggctttgcctctttatcagtttcttcctaactttgag
agttatttggatgatgttaaaaatgtatttttaagtacattttggattcagaaagtgaca
tcaccaacactgattctacatgatgtcagtgacagcattattaacatcaaccttgcacga
aaactctatgctgtagcaaaagccaacgggtcaacgaatgttcggatgatagagtttgac
gagcagcttgatcactgcgaagtttcttctgcaaagcaatttaaaaagttgtttagtgat
tttgtttttcatacctcttga

DBGET integrated database retrieval system