KEGG   Hydra vulgaris: 100201670Help
Entry
100201670         CDS       T01080                                 

Definition
calcineurin B homologous protein 1-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
hmg  Hydra vulgaris
Brite
Protein phosphatases and associated proteins [BR:hmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100201670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 75 aa AA seqDB search
MYDIHRTGGITKDNITHILKLMVGANKSSDQLTAIADRILQEAGNNDGVITFEEFSKIML
KTDFHTKMSIRFLAK
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatattcatagaactggaggaattactaaagacaatattactcatatattaaaa
ctgatggttggcgctaataaatcttctgatcagttgacagcaattgctgatagaatattg
caagaagcagggaataacgatggagttattacttttgaagaattctccaagattatgttg
aaaacggattttcatacaaaaatgagcatcagatttttagcaaaataa

DBGET integrated database retrieval system