KEGG   Hydra vulgaris: 100202298Help
Entry
100202298         CDS       T01080                                 

Definition
thymidine kinase, cytosolic-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hmg  Hydra vulgaris
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hmg00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:hmg00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 237 aa AA seqDB search
MSLDKLLIYRQHSYPHVNNGQIQLIFGPMFSGKTTELLRRITRYSFARYKCLLIKYEKDI
RYSNNGVSTHDQRVHEAVACTVLRDVKHLTKEFDVIGVDEGQFYPDVVQFCEEMAGMKKT
VIVAALDGDFQRKPFGNVIDLVPLAESVIKLSAVCMCCYGEASFTKRLGSDTKVEIIGGA
DKYMAACRGCHKKQIDVVDYINLSKEENRQPLASIDNRQLTRGIFRTKESVAINSTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgataaacttttgatttaccgtcaacattcttatcctcatgttaacaatggg
caaattcagcttatctttggtccaatgttttctggaaaaacaactgaacttctgagaaga
attactcgttacagttttgctcgttacaagtgtttattaattaaatatgaaaaagatatt
cgttatagcaataatggtgtttccacacatgaccaacgagttcatgaagctgttgcatgc
actgttcttcgagatgttaagcatttaactaaagagtttgatgttataggtgttgatgaa
gggcaattttaccctgatgttgtacaattttgtgaagagatggctggaatgaaaaaaact
gtaatagttgcagctcttgatggagattttcaacgtaagccttttggcaatgtgattgat
ctagttccgttagctgagagtgttatcaagttgtcagcagtatgtatgtgttgttatgga
gaagcctcgtttacaaaacggttgggctcagatactaaggtagaaattattggtggcgct
gataaatatatggcagcttgtagaggttgtcacaaaaaacaaattgatgtcgttgattat
ataaatctaagtaaagaagaaaatcgtcagccattagcaagtattgataatcgtcaattg
acgagaggtatatttcgaacaaaagagtctgttgcaataaattctactatgtag

DBGET integrated database retrieval system