KEGG   Hydra vulgaris: 100202298Help
Entry
100202298         CDS       T01080                                 

Definition
thymidine kinase, cytosolic-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hmg  Hydra vulgaris
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100202298
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100202298
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100202298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 237 aa AA seqDB search
MSLDKLLIYRQHSYPHVNNGQIQLIFGPMFSGKTTELLRRITRYSFARYKCLLIKYEKDI
RYSNNGVSTHDQRVHEAVACTVLRDVKHLTKEFDVIGVDEGQFYPDVVQFCEEMAGMKKT
VIVAALDGDFQRKPFGNVIDLVPLAESVIKLSAVCMCCYGEASFTKRLGSDTKVEIIGGA
DKYMAACRGCHKKQIDVVDYINLSKEENRQPLASIDNRQLTRGIFRTKESVAINSTM
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgataaacttttgatttaccgtcaacattcttatcctcatgttaacaatggg
caaattcagcttatctttggtccaatgttttctggaaaaacaactgaacttctgagaaga
attactcgttacagttttgctcgttacaagtgtttattaattaaatatgaaaaagatatt
cgttatagcaataatggtgtttccacacatgaccaacgagttcatgaagctgttgcatgc
actgttcttcgagatgttaagcatttaactaaagagtttgatgttataggtgttgatgaa
gggcaattttaccctgatgttgtacaattttgtgaagagatggctggaatgaaaaaaact
gtaatagttgcagctcttgatggagattttcaacgtaagccttttggcaatgtgattgat
ctagttccgttagctgagagtgttatcaagttgtcagcagtatgtatgtgttgttatgga
gaagcctcgtttacaaaacggttgggctcagatactaaggtagaaattattggtggcgct
gataaatatatggcagcttgtagaggttgtcacaaaaaacaaattgatgtcgttgattat
ataaatctaagtaaagaagaaaatcgtcagccattagcaagtattgataatcgtcaattg
acgagaggtatatttcgaacaaaagagtctgttgcaataaattctactatgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system