KEGG   Hydra vulgaris: 100202497Help
Entry
100202497         CDS       T01080                                 

Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-6-like
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100202497
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     100202497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 346 aa AA seqDB search
MSVNYAAGLSNFPHIHKGNLGLPEIFDSPDVLQKGIDQLVHLIKQSKYMVVHTGAGISTS
AGIPDFRGPNGVWTLEAKGKSPKVSIDFDEAVPTKTHMSILALKQHGIVKYVVSQNIDGL
HLRSGFPRSHLSELHGNMFVEKCEKCQHEYYRCTPVKTMKEQRTGNLCQQKGKRGLSNCR
GKLRDTILDWEASLPPNDLLRAENETKKSDLSLCLGTTLQIVPSGKIPLLTIKNNGKIVI
VNLQKTKYDKKASLLIHSYVDDVMQGVMKGLGLDIPEYNINLYLGIVTYFPDDNISKIKN
QNSNESKEKPIVYATEKVKDDPDEKTLNYPKVENNEENAVKKVKKF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcaattatgctgctggattgagtaattttccccatatacacaaaggaaacctt
ggactgccagagatttttgattcgcctgatgttcttcaaaaaggaattgatcaacttgtt
catcttataaagcagtcaaagtatatggtggtgcacacaggtgctgggataagcacatct
gctggcatacctgattttagaggacctaatggagtttggacacttgaagctaagggaaaa
tcaccgaaagttagtatagattttgatgaagctgtacctaccaagactcacatgagtatt
ttagcacttaaacaacatggaattgtaaagtatgtagtcagtcaaaatattgatggcctt
catcttcgttctggttttccaaggtcacatttatctgaacttcatggtaatatgtttgtt
gaaaaatgtgaaaaatgtcaacatgaatactatcgatgcactcctgtcaaaacaatgaag
gagcaaagaactggtaatttatgtcaacaaaaaggaaagcgtggcttaagcaactgcaga
ggtaaacttcgtgacaccattttggattgggaagccagtttacctccaaatgatctttta
agagcagaaaatgaaacaaagaaaagtgatttgtcgctgtgtttgggaacaactttacag
attgtaccgagtggaaaaattcctcttttaactattaaaaataacggaaagatagttatt
gttaatctccaaaaaacaaaatacgataaaaaggctagcctacttattcattcatacgtc
gatgatgtaatgcaaggagtaatgaaaggcctggggcttgatattccggaatataacatt
aatttatacttgggaattgttacgtattttccagacgataatataagcaaaattaaaaat
caaaatagtaatgaaagtaaagaaaaaccaattgtttacgctaccgagaaagtaaaggat
gaccctgacgaaaaaactctgaattatcctaaagtagaaaacaatgaggaaaatgctgtt
aagaaagtgaaaaaattttaa

DBGET integrated database retrieval system