KEGG   Hydra vulgaris: 100202497Help
Entry
100202497         CDS       T01080                                 

Definition
NAD-dependent protein deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100202497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 374 aa AA seqDB search
DIPVVNMRLNSLESTEEISLARGLRIKVRTLFGPKALSSFRKRITDIISFFSIFDSPDVL
QKGIDQLVHLIKQSKYMVVHTGAGISTSAGIPDFRGPNGVWTLEAKGKSPKVSIDFDEAV
PTKTHMSILALKQHGIVKYVVSQNIDGLHLRSGFPRSHLSELHGNMFVEKCEKCQHEYYR
CTPVKTMKEQRTGNLCQQKGKRGLSNCRGKLRDTILDWEASLPPNDLLRAENETKKSDLS
LCLGTTLQIVPSGKIPLLTIKNNGKIVIVNLQKTKYDKKASLLIHSYVDDVMQGVMKGLG
LDIPEYNINLYLGIVTYFPDDNISKIKNQNSNESKEKPIVYATEKVKDDPDEKTLNYPKV
ENNEENAVKKVKKF
NT seq 1126 nt NT seq  +upstreamnt  +downstreamnt
ggatataccagtagtgaatatgagattaaatagtttagaaagtactgaagaaatatcatt
agcaagaggtttgagaataaaggttagaactctgtttggaccaaaagccttgtcatcatt
tagaaaaagaataactgatattatttcatttttttcaatttttgattcgcctgatgttct
tcaaaaaggaattgatcaacttgttcatcttataaagcagtcaaagtatatggtggtgca
cacaggtgctgggataagcacatctgctggcatacctgattttagaggacctaatggagt
ttggacacttgaagctaagggaaaatcaccgaaagttagtatagattttgatgaagctgt
acctaccaagactcacatgagtattttagcacttaaacaacatggaattgtaaagtatgt
agtcagtcaaaatattgatggccttcatcttcgttctggttttccaaggtcacatttatc
tgaacttcatggtaatatgtttgttgaaaaatgtgaaaaatgtcaacatgaatactatcg
atgcactcctgtcaaaacaatgaaggagcaaagaactggtaatttatgtcaacaaaaagg
aaagcgtggcttaagcaactgcagaggtaaacttcgtgacaccattttggattgggaagc
cagtttacctccaaatgatcttttaagagcagaaaatgaaacaaagaaaagtgatttgtc
gctgtgtttgggaacaactttacagattgtaccgagtggaaaaattcctcttttaactat
taaaaataacggaaagatagttattgttaatctccaaaaaacaaaatacgataaaaaggc
tagcctacttattcattcatacgtcgatgatgtaatgcaaggagtaatgaaaggcctggg
gcttgatattccggaatataacattaatttatacttgggaattgttacgtattttccaga
cgataatataagcaaaattaaaaatcaaaatagtaatgaaagtaaagaaaaaccaattgt
ttacgctaccgagaaagtaaaggatgaccctgacgaaaaaactctgaattatcctaaagt
agaaaacaatgaggaaaatgctgttaagaaagtgaaaaaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system