KEGG   Hydra vulgaris: 100202935Help
Entry
100202935         CDS       T01080                                 

Definition
(RefSeq) histone acetyltransferase KAT2B-like
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100202935
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100202935
Transcription machinery [BR:hmg03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100202935
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100202935
   HAT complexes
    PCAF complex
     100202935
    STAGA complex
     100202935
    TFTC complex
     100202935
    SAGA complex
     100202935
    SLIK complex
     100202935
    ADA-HAT complex
     100202935
    HAT-A2 complex
     100202935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 927 aa AA seqDB search
MASNVLNFHHINNASNNKNTNLTFTGVDPANIKKPPLIIPSELSRPTNIQRITQKKAQVK
AYPKNIKLEKLAVYSSCKAAVDACSCSGWKNPNPTKSIEQQQQQHGLWTTECRTCKHLLS
DHVSHLQEETEEQMNFLMSMVVDIENLFMCVHKETDSDNKQVYFYLFKLLRKSIHQITKP
TVEGPLGKPPFENPNIEMAVKSFVAYKFTNENPVECQIMNELARIFVRCLNHWKLETPTA
RKQRLETVSLLNNKVNILDNELFESNTNADISSYKVDYTRWLCFSHVPLFCDSLQKYDVT
SIFGKKFLRSVFCLMKQQLLDKFSAEKEKLPADTRIKVLEHFPRFLSLFEEEIKSEFSPI
WNDDCSRINPIINPIETNTSSSQLFNDLTQTSIQINENTECKQNLLISSVEPSSTKAVTN
PIKVEPVTSPSKVTSNISLIKSEKSSESIAPKETLTENKPDSKSSVTTLPTETIASLAKA
PTTITSITTASSKSITPLNLPEVSSSEILKRKSNIVETPVTKKMKLLSPIGDVPMEILAR
VIETITDPSKMVGPQGGFYPSQTARDEAARSEERRGLIEFHVIGNSLTKKPSRQTTIWLI
GLQNVFSYQLPRMPKEYITRLVFDPKHRTLALIKDGRPIGGVCFRMFPTQNFTEIVFCAV
SSNEQVKGYGTHMMNHLKDYHTQNGILNFLTYADEYAIGYFKKQGFSKDIKLAKCEYTGY
IKEYEGATLMHCSLNPKIPYREFSLVIKKQKEIVRQLIKEKQEEIKKVYPGLTCFKNGVS
EIPISSIPGIEETGWKQIQKNGKDILLNATAHHGALLNVLNAVKNHASAWPFLKPVPRNE
VPDYYDIIKYPMDLQTMEERLEKKYYTLKKLFVADMSRIFSNCRTYNGPDTEYYKCAGVV
ERYFLTKLKEYYDDSTTIEIKVEEDVS
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaatgtgttaaatttccatcacataaataatgcttcaaacaataaaaataca
aacttgactttcactggagtggatccagctaatataaaaaaacctcctttaattattcca
tctgagttaagtagacctacaaatatacaaagaataacccaaaaaaaagctcaggttaaa
gcctacccaaagaatataaaactagagaagttggctgtttactcatcttgcaaagcagct
gttgatgcttgttcatgcagcggttggaaaaatccaaatcctactaaatctattgagcag
cagcagcaacagcatggcctttggaccacagaatgccgaacatgcaaacatttattgtct
gaccatgtttctcatttgcaagaagaaactgaagagcaaatgaactttttaatgtccatg
gttgttgatattgaaaatttatttatgtgtgttcacaaagaaactgacagtgataataaa
caggtgtacttttatttatttaaattattgcgcaagtctattcatcaaataacaaaacca
acagttgaaggtccgcttggtaaaccaccgtttgaaaatcctaacattgaaatggcagtt
aaaagctttgtagcatacaagtttactaatgaaaatcctgttgaatgccagataatgaat
gaacttgcacgcatttttgtgcggtgtttaaaccattggaagttagagacacctacagct
cgaaagcagaggctagaaacagtttctcttctaaataataaagttaacatattagataat
gaactttttgaaagtaataccaatgctgatatttcatcatataaagttgattatacaagg
tggctgtgctttagtcatgttccacttttttgtgatagtttacaaaagtatgatgtgaca
tcaatttttggaaagaaatttttaaggtctgtgttttgtctaatgaagcagcagcttctt
gacaagttttcagcagaaaaagagaaacttcctgcagacactagaattaaagttttggag
cattttccaaggtttcttagtcttttcgaggaagaaataaagtctgagttttcaccaata
tggaatgatgactgcagtagaattaacccaataataaatccgatagaaacaaatacctca
tcatcacagttatttaatgatttaacacaaacttctattcaaataaatgaaaatacagaa
tgcaaacaaaatttactaatatcttcagtcgagccatcaagcacaaaagctgtcaccaac
ccaataaaagttgaacctgttactagtccatcaaaagttacatctaatattagtttaata
aaatctgaaaaaagctcagagtctattgctccaaaagaaactttgactgaaaacaaacca
gattctaaatcctcagtaactacattacctacagaaaccatagcatctttagcaaaggct
ccaactacaataacctcaataacaacagcaagttcaaagtcaataacaccactaaattta
cctgaagtatcttcttcagaaattttaaaaagaaagtcaaacattgtagaaactcctgta
acaaagaagatgaagttgcttagcccaataggagatgtaccaatggaaatcttggctaga
gtaattgaaactattactgatccctccaaaatggttgggcctcagggaggattttatcca
tcacagactgctcgtgatgaggcagcacgcagtgaagagcgtcgtggtcttattgagttt
catgttattggaaattcattaaccaagaaaccatctcgccaaacaacaatttggttaatt
ggtttacagaatgtattttcatatcaattgccaagaatgcctaaagaatacataacccgc
cttgtttttgatcccaagcatcgaacattggccttaataaaagatggtcgtccaatcggt
ggtgtttgtttccgaatgtttcccacacaaaatttcactgagattgttttttgtgctgta
tcatcaaatgaacaagtcaagggttatggaactcacatgatgaaccatcttaaagattat
cacacacaaaatggtatacttaactttctaacttatgctgatgaatatgcaattggctat
tttaaaaaacagggattttctaaagatattaagttggcaaaatgtgaatatactggatat
atcaaagagtatgaaggtgcaacactcatgcattgttccttaaatccaaaaataccttac
agagagttttctttagttattaaaaagcaaaaagagattgttcgtcaattgattaaagaa
aaacaggaggaaataaaaaaagtatatcctggattgacatgttttaaaaatggagtatct
gaaatacccatatcaagtatacctggaatagaagagactgggtggaagcaaattcaaaag
aatggcaaagatatcttattgaatgcaactgctcatcatggcgctttacttaacgtacta
aatgcagtcaagaatcatgcaagcgcttggcctttcctcaaacctgttcctcgaaacgaa
gtcccggactactatgatattattaaatatccaatggatttgcagactatggaagaaaga
ttagaaaagaagtattacacccttaaaaaactatttgttgcagatatgtctcgtatattt
tctaattgtagaacatataacggtcctgatacggaatattataagtgcgcaggcgtagta
gaacgatattttttaacaaagttaaaagagtactacgacgattctacgacaatagaaata
aaagtagaagaagatgtgtcctga

DBGET integrated database retrieval system