KEGG   Hydra vulgaris: 100202935Help
Entry
100202935         CDS       T01080                                 

Definition
histone acetyltransferase KAT2B-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hmg04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 850 aa AA seqDB search
MVNAMKTKTGNGIPAKRVQLRENNISSSELADFINSNTMRFFVILGISTSWLELDSSLWN
KDQVFIATKHFVAGLSVVNDRAERGVALIQDFNQILTKDEGQKQALLQVVIKKFMTIFNC
QTLIDSFKFSPRFSVKVTGSLAVKSFVAYKFTNENPVECQIMNELARIFVRCLNHWKLET
PTARKQSNTNADISSYKVDYTRWLCFSHVPLFCDSLQKYDVTSIFGKKFLRSVFCLMKQQ
LLDKFSAEKEKLPADTRIKVLEHFPRFLSLFEEEIKSEFSPIWNDDCSRINPIINPIETN
TSSSQLFNDLTQTSIQINENTECKQNLLISSVEPSSTKAVTNPIKVEPVTSPSKVTSNIS
LIKSEKSSESIAPKETLTENKPDSKSSVTTLPTETIASLAKAPTTITSITTASSKSITPL
NLPEVSSSEILKRKSNIVETPVTKKMKLLSPIVIGDVPMEILARVIETITDPSKMVGPQG
GFYPSQTARDEAARSEERRGLIEFHVIGNSLTKKPSRQTTIWLIGLQNVFSYQLPRMPKE
YITRLVFDPKHRTLALIKDGRPIGGVCFRMFPTQNFTEIVFCAVSSNEQVKGYGTHMMNH
LKDYHTQNGILNFLTYADEYAIGYFKKQGFSKDIKLAKCEYTGYIKEYEGATLMHCSLNP
KIPYREFSLVIKKQKEIVRQLIKEKQEEIKKVYPGLTCFKNGVSEIPISSIPGIEETGWK
QIQKNGKDILLNATAHHGALLNVLNAVKNHASAWPFLKPVPRNEVPDYYDIIKYPMDLQT
MEERLEKKYYTLKKLFVADMSRIFSNCRTYNGPDTEYYKCAGVVERYFLTKLKEYYDDST
TIEIKEEDVS
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgcaatgaaaacaaaaactggaaatggaattcctgcaaaacgtgttcaacta
cgtgaaaacaacatttcatcgtcagagcttgctgatttcattaactcgaacaccatgagg
ttttttgttatactgggcatctcaacttcttggctcgaattggattcatctttgtggaac
aaggaccaagtttttattgcaactaagcattttgtagccggtttgagcgttgtgaatgac
agagcagagagaggagttgctcttatccaagactttaaccaaattctaacaaaagatgaa
ggacaaaagcaagcacttctccaggtcgtaattaaaaagtttatgacaatattcaactgt
caaacattaattgactcttttaaattttctcctagattttcagttaaagttactggttct
ttggcagttaaaagctttgtagcatacaagtttactaatgaaaatcctgttgaatgccag
ataatgaatgaacttgcacgcatttttgtgcggtgtttaaaccattggaagttagagaca
cctacagctcgaaagcagagtaataccaatgctgatatttcatcatataaagttgattat
acaaggtggctgtgctttagtcatgttccacttttttgtgatagtttacaaaagtatgat
gtgacatcaatttttggaaagaaatttttaaggtctgtgttttgtctaatgaagcagcag
cttcttgacaagttttcagcagaaaaagagaaacttcctgcagacactagaattaaagtt
ttggagcattttccaaggtttcttagtcttttcgaggaagaaataaagtctgagttttca
ccaatatggaatgatgactgcagtagaattaacccaataataaatccgatagaaacaaat
acctcatcatcacagttatttaatgatttaacacaaacttctattcaaataaatgaaaat
acagaatgcaaacaaaatttactaatatcttcagtcgagccatcaagcacaaaagctgtc
accaacccaataaaagttgaacctgttactagtccatcaaaagttacatctaatattagt
ttaataaaatctgaaaaaagctcagagtctattgctccaaaagaaactttgactgaaaac
aaaccagattctaaatcctcagtaactacattacctacagaaaccatagcatctttagca
aaggctccaactacaataacctcaataacaacagcaagttcaaagtcaataacaccacta
aatttacctgaagtatcttcttcagaaattttaaaaagaaagtcaaacattgtagaaact
cctgtaacaaagaagatgaagttgcttagcccaatagtaataggagatgtaccaatggaa
atcttggctagagtaattgaaactattactgatccctccaaaatggttgggcctcaggga
ggattttatccatcacagactgctcgtgatgaggcagcacgcagtgaagagcgtcgtggt
cttattgagtttcatgttattggaaattcattaaccaagaaaccatctcgccaaacaaca
atttggttaattggtttacagaatgtattttcatatcaattgccaagaatgcctaaagaa
tacataacccgccttgtttttgatcccaagcatcgaacattggccttaataaaagatggt
cgtccaatcggtggtgtttgtttccgaatgtttcccacacaaaatttcactgagattgtt
ttttgtgctgtatcatcaaatgaacaagtcaagggttatggaactcacatgatgaaccat
cttaaagattatcacacacaaaatggtatacttaactttctaacttatgctgatgaatat
gcaattggctattttaaaaaacagggattttctaaagatattaagttggcaaaatgtgaa
tatactggatatatcaaagagtatgaaggtgcaacactcatgcattgttccttaaatcca
aaaataccttacagagagttttctttagttattaaaaagcaaaaagagattgttcgtcaa
ttgattaaagaaaaacaggaggaaataaaaaaagtatatcctggattgacatgttttaaa
aatggagtatctgaaatacccatatcaagtatacctggaatagaagagactgggtggaag
caaattcaaaagaatggcaaagatatcttattgaatgcaactgctcatcatggcgcttta
cttaacgtactaaatgcagtcaagaatcatgcaagcgcttggcctttcctcaaacctgtt
cctcgaaacgaagtcccggactactatgatattattaaatatccaatggatttgcagact
atggaagaaagattagaaaagaagtattacacccttaaaaaactatttgttgcagatatg
tctcgtatattttctaattgtagaacatataacggtcctgatacggaatattataagtgc
gcaggcgtagtagaacgatattttttaacaaagttaaaagagtactacgacgattctacg
acaatagaaataaaagaagaagatgtgtcctga

DBGET integrated database retrieval system