KEGG   Hydra vulgaris: 100203161Help
Entry
100203161         CDS       T01080                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
hmg  Hydra vulgaris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100203161
Enzymes [BR:hmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100203161
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100203161
  Exosomal proteins of colorectal cancer cells
   100203161
  Exosomal proteins of bladder cancer cells
   100203161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 490 aa AA seqDB search
MAVGLILVLISISSVFCSDVLELTDSTFKAGIENEEIILVEFYAPWCGHCKRLAPEYEIA
ATALLKNDPPVKLAKVDCVGEGKESCSKYGVSGYPTLKIFRNGGFSQEYDGPRESAGIIS
YMKKNSGPSSVLLRDFEHLQLKLSDAADVTIVGFFASEDHKFKSFMKAADQKRTDFNFAH
SLSNEINKQAGHIDELVLYRPKHLHANFEKAEETLNTYLDTSNIIKFITEKANGIVGQIK
PETEDKFPRPLVVVYYDVDWKKNPKGSKYWRNRVARVAKKFVNEINFAIGARADYTKQLT
DLGFDTVESNLDPNAVAFDVKGSKFKMTTDFSVENLEKFTNEFKNEELKPYIKSEPLPVD
NNGPVKIVVGENFNEIVNDPTKDVLIEFYAPWCGHCKSLEPKYKELGEKLAGVKDIVIAK
MDATANDVPPPYEVSGFPTIYWAPAGNKQSPKKYNSAREVDSFIEFIKTEATKPFKLPDS
KSKKKTKKEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcggttggtttaatcctcgtgttaatttcaattagttctgttttttgtagtgatgtt
ttagaattaacagattcaacatttaaagctggaatagaaaatgaagaaataattttggtt
gaattttatgctccttggtgtgggcattgcaaaagattagcaccagaatatgaaattgct
gctactgctcttctcaaaaatgatccccctgttaaattagcaaaggttgattgtgttgga
gaaggaaaagaaagctgtagcaagtatggtgttagtggttatcctacgttaaaaatcttt
cgaaatggtggtttttcacaagaatatgatggtccacgtgaatctgctggaattatttct
tacatgaagaagaattctggaccttcctcagtactattgagagattttgagcatctacag
ctaaagttgtcagatgcagctgatgtaactattgttggttttttcgccagtgaagatcat
aaatttaaaagttttatgaaagcagctgatcaaaaaagaactgattttaactttgcacac
tcattaagtaatgaaatcaataaacaagcaggacatatagatgagttagtgctttaccgc
ccaaagcatttacatgccaactttgaaaaggctgaagaaacactaaatacttatttagat
acttctaacattattaaatttataacagaaaaggccaatggaattgtgggtcaaattaaa
cctgaaacagaagataagttcccaaggccattagttgttgtgtattatgatgtagactgg
aagaaaaatcctaaaggttctaaatactggagaaatcgtgtggctagagtggccaagaag
tttgtaaatgaaattaattttgctattggtgctcgagcggattacacaaaacaacttact
gatttaggatttgatactgttgaatcaaatcttgatcccaatgctgtggcatttgatgta
aaaggttctaagtttaagatgacaacagattttagtgttgaaaatcttgaaaagtttaca
aatgagttcaagaatgaagaattaaaaccatatattaagtctgagcctttacctgttgat
aacaatggtccagttaaaattgttgtgggagagaatttcaatgagattgttaatgatcca
actaaagatgtgcttatagagttttatgctccatggtgtggtcattgtaaatctcttgaa
cctaagtacaaggaacttggtgaaaagttagctggtgttaaagatattgttattgcaaaa
atggatgctactgcaaatgatgtaccacctccttacgaagtcagtggattccccactatc
tactgggcaccagctggaaataaacagagtcccaagaagtacaattctgcacgcgaagta
gacagctttattgaatttataaaaacagaagcaactaaaccttttaaattacctgactca
aagtccaaaaagaaaacaaaaaaagaactttaa

DBGET integrated database retrieval system