KEGG   Hydra vulgaris: 100203161Help
Entry
100203161         CDS       T01080                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
hmg  Hydra vulgaris
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hmg04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 490 aa AA seqDB search
MAVGLILVLISISSVFCSDVLELTDSTFKAGIENEEIILVEFYAPWCGHCKRLAPEYEIA
ATALLKNDPPVKLAKVDCVGEGKESCSKYGVSGYPTLKIFRNGGFSQEYDGPRESAGIIS
YMKKNSGPSSVLLRDFEHLQLKLSDAADVTIVGFFASEDHKFKSFMKAADQKRTDFNFAH
SLSNEINKQAGHIDELVLYRPKHLHANFEKAEETLNTYLDTSNIIKFITEKANGIVGQIK
PETEDKFPRPLVVVYYDVDWKKNPKGSKYWRNRVARVAKKFVNEINFAIGARADYTKQLT
DLGFDTVESNLDPNAVAFDVKGSKFKMTTDFSVENLEKFTNEFKNEELKPYIKSEPLPVD
NNGPVKIVVGENFNEIVNDPTKDVLIEFYAPWCGHCKSLEPKYKELGEKLAGVKDIVIAK
MDATANDVPPPYEVSGFPTIYWAPAGNKQSPKKYNSAREVDSFIEFIKTEATKPFKLPDS
KSKKKTKKEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcggttggtttaatcctcgtgttaatttcaattagttctgttttttgtagtgatgtt
ttagaattaacagattcaacatttaaagctggaatagaaaatgaagaaataattttggtt
gaattttatgctccttggtgtgggcattgcaaaagattagcaccagaatatgaaattgct
gctactgctcttctcaaaaatgatccccctgttaaattagcaaaggttgattgtgttgga
gaaggaaaagaaagctgtagcaagtatggtgttagtggttatcctacgttaaaaatcttt
cgaaatggtggtttttcacaagaatatgatggtccacgtgaatctgctggaattatttct
tacatgaagaagaattctggaccttcctcagtactattgagagattttgagcatctacag
ctaaagttgtcagatgcagctgatgtaactattgttggttttttcgccagtgaagatcat
aaatttaaaagttttatgaaagcagctgatcaaaaaagaactgattttaactttgcacac
tcattaagtaatgaaatcaataaacaagcaggacatatagatgagttagtgctttaccgc
ccaaagcatttacatgccaactttgaaaaggctgaagaaacactaaatacttatttagat
acttctaacattattaaatttataacagaaaaggccaatggaattgtgggtcaaattaaa
cctgaaacagaagataagttcccaaggccattagttgttgtgtattatgatgtagactgg
aagaaaaatcctaaaggttctaaatactggagaaatcgtgtggctagagtggccaagaag
tttgtaaatgaaattaattttgctattggtgctcgagcggattacacaaaacaacttact
gatttaggatttgatactgttgaatcaaatcttgatcccaatgctgtggcatttgatgta
aaaggttctaagtttaagatgacaacagattttagtgttgaaaatcttgaaaagtttaca
aatgagttcaagaatgaagaattaaaaccatatattaagtctgagcctttacctgttgat
aacaatggtccagttaaaattgttgtgggagagaatttcaatgagattgttaatgatcca
actaaagatgtgcttatagagttttatgctccatggtgtggtcattgtaaatctcttgaa
cctaagtacaaggaacttggtgaaaagttagctggtgttaaagatattgttattgcaaaa
atggatgctactgcaaatgatgtaccacctccttacgaagtcagtggattccccactatc
tactgggcaccagctggaaataaacagagtcccaagaagtacaattctgcacgcgaagta
gacagctttattgaatttataaaaacagaagcaactaaaccttttaaattacctgactca
aagtccaaaaagaaaacaaaaaaagaactttaa

DBGET integrated database retrieval system