KEGG   Hydra vulgaris: 100203193Help
Entry
100203193         CDS       T01080                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
hmg  Hydra vulgaris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100203193
Enzymes [BR:hmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100203193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 437 aa AA seqDB search
MFKYLGVGLAIIYVVNALYEKSDDVVELTGGNFDHLVKYSDEIWLVEFYAPWCGHCKNLA
PDWKKAATALKGIVKVGAVDMDVHGSVGGPYNVRGFPTIKIFSGDKSKPQDYNGARSAQA
IVDEALKVASALARERLNGGSKRSSSGSGKSGNAKDVITLTDDNFEKEVIDTKDIVFVEF
FAPWCGHCQRLEPEWAKAATELKGKVKLAALDATQYPNTAGRFNVQGYPTIKYFPAGAKD
FNSAEDYQGGRTASDIIAFALDLHSANVDPPEIQQLTSDSVLKDNCNEKPLCVISFLPDI
LDTQAAGRNAYLDLLRELGEKYKKKLWGWVWTSAGVHPKLEKTLEVGGFGYPAMAVVNIK
KKIFVLLRSGFGREGIDELLKGIAVGRGRTQKLEDGLPTLSDAPAWDGKDGELPVEEEDI
DLSDVVLDDEPEKKTEL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatatctaggtgtaggactagcaataatttatgttgtaaacgctctttatgaa
aaatcagatgatgtagtagaacttactggtggaaattttgatcatttggtaaaatatagc
gacgagatatggctcgtagagttctatgcaccatggtgtggccattgcaagaatcttgca
ccagattggaagaaagcagcaacggctttgaaaggcatagttaaagttggtgctgttgac
atggatgttcatggttcagttggaggtccttataatgttcgtgggttccctactattaaa
atattttctggtgacaaatccaaaccacaagattacaatggtgcacgatctgcccaagct
atagttgatgaagcattaaaagttgcatctgcattggctcgtgagagactcaatggtggt
tcaaaacgctcatcaagtggaagtggcaagagtggaaatgcaaaagatgttattactctt
actgatgataattttgaaaaagaagttattgatacaaaagatattgtttttgttgaattc
tttgctccatggtgtggtcattgtcaacgtttagaaccagagtgggcaaaagctgctaca
gaacttaaaggaaaagtaaaactagctgcattggatgcaacacaatacccaaatacagct
ggaaggtttaatgttcaaggttatcctaccatcaaatacttccctgctggggcaaaggat
tttaattcagctgaagattaccaaggagggcgcactgcaagtgacatcattgcttttgct
cttgacttgcattctgcaaatgtagatcctccagaaattcagcaacttacctctgattca
gttttaaaagataattgtaatgaaaaaccactttgtgttatttcgtttttaccagatatt
cttgatactcaagctgctggaagaaatgcgtatttagatcttttacgagagttaggtgaa
aagtataaaaagaagttatggggttgggtatggacaagtgctggagtacatcccaagtta
gaaaaaacacttgaagtaggaggatttggatatcccgcaatggctgttgttaacattaaa
aagaagatatttgttttattacgaagtggcttcggtcgtgaaggtattgatgaattgcta
aaaggtatcgctgttggtcgtggtcgaactcagaagttagaagatggtttgcctactctg
tcagatgcacctgcttgggatggtaaagatggggagttgcctgtagaggaagaagacata
gacttaagtgatgtagttttagatgacgaacccgaaaagaagactgagctttaa

DBGET integrated database retrieval system