KEGG   Hydra vulgaris: 100203474Help
Entry
100203474         CDS       T01080                                 

Definition
CREB-binding protein-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100203474
   04330 Notch signaling pathway
    100203474
   04350 TGF-beta signaling pathway
    100203474
   04630 Jak-STAT signaling pathway
    100203474
   04068 FoxO signaling pathway
    100203474
Enzymes [BR:hmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100203474
Transcription factors [BR:hmg03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100203474
Mitochondrial biogenesis [BR:hmg03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100203474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2142 aa AA seqDB search
MMSDPDRMGENKGPPSKRPRADSPLETPIADHSGGFSYENILNDLPDDVIINNSSNENSL
SNGNDLLSSLESYDINNSNENLISNGPTSLQANMEKGGLHSLPSGIQMNVSKALGMLSPQ
PGMNIYSQIMPPQGPVSTSAMPTPATPMLNPASMRSGNMMQANVPMSSTSNSIMNSISPQ
SSYTSNPMQNTMMQNNTPISLMQAMSTNSIYNNQISMSNSMASNMNLMNMNQNFMNQGFT
NNMHMMQNNRLYQNNLASAGFRMGMNPKMPSIQNNFNPMGQMINSPMNNMVMPENSCQDT
MMMTNNMGNSGMLPMQRMHSQMRFEMNANMNVMANNLLNGPGFQPGIPNMSGNSMVLNMN
RPQLNPNILDVQMQRMAPMNANDPSMQMNQPLNQQQMQQPGNPNAPVSTTADPEKKRLIQ
QQLVLLLHAHKCQRREQQAPNGEYKPCDLPHCRTMKSVLNHMTVCKAGKDCQVAHCASSR
QIISHWKFCNRTDCPVCLPLKNGPTSRRLGGNEPRDSNNDNVNRGNIPPGTQTNPSSTNE
DREAWHKSVTQSQRNHLVERLVSAIIPKARNDPMTMKNKQMENLVLYAQKVEDDMYSTAA
SKEDYFHLLAEKIYKIQKDLEEKRMERLRKNSSNMINPQQAQNQINGPNNMMNPANISLQ
PVSNMNVQVSTNLNMAFQQQPPSNGPQNLIQNNVNVSDYLSNNGNMTNGMNSFDFFQQPN
IQSLQHINNQPSSMMSNMNPKGMQRSMNAMGQRQRANLSSFQNAALSNQQMQAMQQQIPQ
QQLFYQQNLQLQQQMNLLQQKNQMLPQQQQQILQNTLTPPPSALGSNQVKMEISGSPQLQ
PQQSSNNQNLLISNCGDASPNVRTIKKEVSFDNSPMNVKIENISSPMNVETENVATSISE
IKPVIKTELSTTPCPIGQKPSQQVASNTNPVALVKQEALPSPSSTTPDERTKSHKVWTVE
ELTENLLPLFDKVYNIQPESGPFRKPVNPEILHIPDYFTIVKNPMDLSSIKKKLEEGGYK
DPWGFCDDMRLMFENAWLYNKKTTKVFRYCTKLSETFEADIEPIMKKLGYCCGRKYVFNP
QVLYCYGKNLCSIPRDTPYYSYQNRYHYCERCFKEFEGESIDLGEDSGLRTSIINKNEFE
KLKNDHLDLEPFVTCVECGRKMHQVCVLHLDIIYENGYICPTCREEKKLGNRVENRYSAR
NLPQSKLAEHIENRVNNFLKTQVTDESPGYIHIRIVSSVEKVVEVRQGMRSRYGNEFPEK
FPYRARALFAFEEIDGVDVCFFGMHTQEFGSDCPEPNRNRIYLSYLDSVHFFRPPHLRTS
VYHEILIGYFDFCKNRGFHYGHIWSCPPSEGDDYIFHCHPVEQKIPKHKRLVEWYKVMLN
KACEDGVMAGYKDMFTQAIEDEITSPTQIPYFEGDYWPNAIEESIREISQEEEERRKTEA
MQAAAQLGTDNCEENAVYEMQVALSTGKKAKGSNKRANKKTSKKSKLNKTPAKKTVPNAM
GASELSQRVFTTMEKFKEIFFVLHLHSPANMPTKKIEDPDPVMSCDIMDGRDAFLTLSRE
RHWEFSTLRRAKFSTLAMLVELHNQGSDRFVYSCNLCKGQIINRYHCTVCEDYDLCIECY
NQKGHEHKMEKLGLDIESETPNLTKTPSSAQEARRQSIELCIKSLEHATDCLDKNCKSSS
CVKMKKVVSHAKSCKRKTNHGCPICKQLIALCCYHAKSCKKPQCTVPYCQHIKAKMKQQQ
LQQKVHQQQVLRRRIEAMRMSQNPPIQGSIQLPTRMPQRQTPPNDIQKTIVPITSVPPNV
LIQQQMPNPNVQFPIDKSNGINANIAIMNNSNNRFFGQPVQTNMLNQTRINPWQQQQQHS
LGAQFNGFNGMPVQTNINTSVNPSQNLHLEQFRNVMCVGNGVNMKSNQIFDYIQSHKVRN
NNFMPNVNNQSLTNQNNLNQVWNMHNKRMQQNLQQQQQQQLQQRRMPMNMNIMNSGSVFP
QQSNPRLLSRQFSQEMLPPVGGIINNQSSPQMMGGRITPGSQMMSPQSSIMSPPLPMKPN
PSPRLCMSPSHSMRVPSPHSVNSPQHIPFSPQHQHQSLTSPMHQIISPAQSNSIDSLQPP
TSVLSDRGDGMTPHMQNTSDINGGENDVDDFPDPLLKFVSQL
NT seq 6429 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgacccagatcgtatgggagaaaataaaggacctccttcaaagcgaccaaga
gctgattcaccactggaaactccaattgcagatcattcaggaggattttcatatgaaaat
attctcaatgatttgccagatgatgttatcattaataatagtagcaacgagaattcttta
tcaaatgggaacgatcttttaagtagtttggagtcttatgatattaacaattccaatgag
aaccttatttcaaatggtccaacatcattacaagcaaatatggagaagggcggtctccat
agtcttccatctggaattcaaatgaatgtttctaaggctttaggaatgttaagtccccaa
cctggaatgaatatttactcacaaattatgccgccacaaggaccagtgagtactagtgcc
atgccaacaccagctactcctatgctaaatccagcatcaatgaggtctggaaatatgatg
caggcaaatgttccaatgtctagcacttctaactcaataatgaattctatttctcctcag
tcttcctacaccagtaatccaatgcagaatactatgatgcaaaacaatactcctattagt
ttaatgcaagctatgtcaactaactctatttataataatcaaataagtatgtcaaattca
atggcatcaaacatgaacttgatgaacatgaatcaaaatttcatgaatcaaggatttaca
aacaatatgcacatgatgcaaaataatagattgtatcaaaataatttggcatctgctgga
ttcagaatgggcatgaatcctaagatgccttctatacaaaacaattttaatcctatgggt
caaatgataaatagtccaatgaacaacatggttatgccagaaaatagttgtcaggacaca
atgatgatgacaaataatatgggaaattctggaatgttacctatgcaaaggatgcattct
caaatgcgtttcgaaatgaatgcaaatatgaatgtcatggctaataacctacttaatggt
ccaggatttcaaccaggtattcctaatatgagtggaaattcaatggtattaaatatgaat
cgacctcagctaaatccaaatattctggatgtacaaatgcaaagaatggcaccaatgaat
gctaatgatccatcaatgcaaatgaatcaacctttaaatcaacaacaaatgcagcaaccg
ggaaatcccaatgcaccagtttctactacggctgatccggagaagaagcggttaattcag
caacaattagttttgttgttgcatgctcataaatgtcagcggagagagcaacaagctcct
aatggtgaatacaagccttgtgacttgccacattgtagaacaatgaaaagtgtgttgaac
cacatgactgtttgcaaggcaggcaaagattgtcaagttgcacactgtgcctcatcgcgt
caaatcatctctcattggaagttctgtaatcggacagattgcccagtttgtctaccatta
aaaaatggacctactagtagaaggctgggtggaaatgagccaagagattctaacaacgac
aatgtaaatcgtggaaatatacccccaggaacacagactaatccatcttcaactaatgaa
gacagagaagcctggcataaatcagttacacaaagtcaacgcaatcatcttgtagagaga
ctagtgtcagctattataccaaaagctagaaatgatcctatgactatgaaaaataaacaa
atggaaaatcttgtgctctatgcacaaaaagtagaagatgatatgtacagcacagcagca
agcaaggaagattattttcatctattggccgaaaaaatatataaaatccaaaaagacctt
gaagaaaaacgtatggaaaggttacgaaaaaacagttcaaatatgattaacccccaacaa
gcacaaaatcaaataaatggacctaataatatgatgaaccctgcaaatattagtttgcaa
cctgtttcaaatatgaatgttcaggtgtctacaaacctcaatatggcatttcaacagcaa
cctccgtcaaatggacctcaaaatcttattcaaaataatgtcaatgtatcagattatctt
agtaataatggaaatatgacaaatggtatgaactcatttgatttttttcaacaacctaat
attcagtctttacaacacataaacaatcagcctagttctatgatgtccaatatgaatcca
aaaggaatgcaaaggagtatgaatgcgatgggtcaacgtcagcgcgcaaatctttcttcg
tttcaaaatgcagcactgagcaaccagcaaatgcaagcaatgcaacagcagattcctcaa
cagcaattattttatcaacaaaatcttcaactgcaacaacaaatgaatttactccaacaa
aaaaaccaaatgttgcctcaacaacagcaacagatacttcaaaatactttgacacctcct
ccttcagcactaggatcgaaccaagtaaagatggaaattagtggtagtcctcagcttcaa
cctcaacaatcgtcaaataatcaaaatcttttgataagtaattgtggtgatgcttcacct
aatgtacgaactattaaaaaagaagtaagttttgataacagccctatgaatgtaaaaatt
gaaaatatttcatcgccaatgaatgttgagacagaaaatgtagcaacatctatctctgaa
attaagcctgttatcaagacagaactttccactactccttgtccaattggacaaaaacct
tctcaacaagtagcatcaaataccaatcctgtagctttagttaaacaagaagctttaccc
agtccttcatcaacaactcctgatgaacgtactaaatcacataaagtttggactgttgaa
gagctaacagaaaatttgcttccactgttcgataaagtttataacattcaacctgaatct
gggcctttccgaaaaccagtcaacccagagattcttcatatacctgattatttcactatt
gtcaaaaatccaatggacttatcttcaattaaaaagaagttagaagaaggtggttacaaa
gatccctggggtttttgtgatgacatgaggttaatgtttgaaaatgcttggctatacaat
aaaaagacaactaaagtttttcgttattgtaccaaactttcagaaacatttgaagcagac
attgaaccaattatgaaaaaacttggatattgttgtggaagaaagtatgtttttaaccca
caagtcttatattgttatggaaaaaatctttgttcaattccaagagataccccttattat
tcatatcaaaacaggtatcactattgtgaaagatgttttaaagaatttgaaggagaatct
attgatttaggcgaagattcaggtttaaggacaagcattattaataaaaatgaatttgaa
aagttgaaaaatgatcacttggatttggaaccatttgtaacttgtgttgaatgcggtaga
aaaatgcatcaagtatgtgttcttcacttggacatcatatatgaaaatggttatatttgc
ccaacttgtcgagaagaaaaaaaacttggaaacagagtagaaaaccgctacagtgcgcgc
aatttgccgcaatctaaattggctgagcatatagagaatcgtgtaaacaactttttaaaa
actcaagttactgatgagtcacctggttacattcatatccgcatagtcagtagtgttgaa
aaggttgttgaagttcgacaaggaatgagatccagatatggtaatgaatttccagaaaaa
tttccataccgagcacgagcattgtttgcttttgaagaaatagatggtgttgatgtttgc
ttttttggtatgcatacacaggagtttggttctgactgccctgagccaaatagaaatcgt
atttacttgtcttatttagacagtgttcatttttttcgcccacctcatttacgcacaagt
gtgtaccatgaaatcttaattgggtacttcgatttttgcaaaaataggggatttcattat
ggtcatatatggtcctgtcctcctagtgaaggtgatgactacatatttcattgtcatcca
gtagaacaaaaaattccaaaacacaaacgtcttgttgagtggtacaaagtcatgttaaat
aaagcatgtgaagatggtgtaatggctggctataaggatatgtttactcaagcaatcgaa
gatgaaattacctcacctactcaaataccttattttgaaggagactattggcctaatgct
attgaagagagtattcgtgaaattagccaagaagaagaagagcgacgtaaaacagaagct
atgcaggctgctgcacagttgggtactgataattgtgaagaaaatgctgtttatgaaatg
caggtagcattatccactggtaaaaaagctaaaggtagtaacaaaagagctaataaaaaa
actagtaaaaaaagtaaactaaataaaacaccagctaaaaaaacagtacctaatgccatg
ggtgcatctgaattatctcaaagagtttttactacaatggaaaagttcaaagagattttc
tttgttctgcatcttcacagccctgcaaatatgcccacaaaaaaaattgaagatcctgat
cctgttatgtcttgtgatataatggatggtcgagatgcttttctgactttatcaagagag
aggcattgggaattctcaactcttcgcagggcaaagttttctactctggctatgcttgta
gagctccataatcaaggctctgatcgctttgtttacagttgtaatttatgtaaaggacag
attattaatcgatatcattgtactgtttgtgaggattatgatttatgtattgaatgctat
aatcaaaaaggccacgaacataaaatggaaaaacttggattagatattgaaagtgagaca
ccgaatctcacaaaaactcctagtagtgcacaagaagctcgccgacagtctattgagtta
tgtataaaatctcttgagcatgcaacagattgtttggataaaaattgtaaatcgtcaagc
tgcgtaaaaatgaaaaaagttgtttcacatgctaaaagttgtaagcggaaaactaatcat
ggttgtccgatttgcaaacagcttattgcactttgttgttatcatgcaaaatcatgcaag
aaaccccaatgtacagtaccatattgtcagcatattaaagctaagatgaaacaacagcag
cttcagcaaaaagtccaccaacagcaagtacttcggcgccgaattgaagcaatgagaatg
agtcaaaatcctccaatacaaggtagtatacaattacctactcgtatgcctcagaggcag
actcctcctaacgatattcaaaaaacaattgttcctataacaagtgttcctccaaatgtt
ttaattcaacaacaaatgccaaatccaaatgttcaattcccaatagataaatcaaacgga
ataaatgctaatattgctataatgaacaactcaaataataggttttttggccagccggtt
caaacaaatatgctcaatcagacaagaattaatccgtggcaacaacaacagcagcatagt
ctaggagcacaattcaatggttttaatggaatgccagtacagactaatataaatacatct
gttaatccatctcaaaatcttcatttagaacagtttaggaatgttatgtgtgtaggcaat
ggtgtaaatatgaaatcaaatcaaatatttgactatatacaatctcataaagtgagaaat
aataattttatgccaaatgtgaataatcaatctttgactaatcaaaataatttaaaccaa
gtatggaacatgcacaataagcgcatgcaacaaaacttacagcagcagcagcaacagcaa
cttcaacaacgtagaatgccaatgaatatgaatataatgaattcaggatctgtgtttcct
caacagtccaatcctcgccttttaagtagacaattttcacaggagatgcttcctcctgta
ggtggtataataaataatcaatcttcgcctcaaatgatgggtggtcgaataactcctgga
tctcaaatgatgtctcctcaaagcagtattatgtctccgcctttacctatgaaaccaaat
ccttcacctcgactatgtatgtccccgtcacattcaatgcgtgttccttctcctcattct
gtaaattctcctcaacacataccgttttctcctcagcaccagcatcagtccttaacttct
cctatgcatcaaatcatatctccggcacaatcgaactctattgactcattacaaccacca
acctctgttctttcagacagaggggatggtatgacaccccatatgcagaatacctcagat
ataaatggaggagagaacgatgttgacgattttcctgaccctcttctgaaattcgtttca
cagctctga

DBGET integrated database retrieval system