KEGG   Hydra vulgaris: 100203621Help
Entry
100203621         CDS       T01080                                 

Definition
dual specificity mitogen-activated protein kinase kinase 5-like
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
hmg  Hydra vulgaris
Module
MAPK (ERK5) signaling
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100203621
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   100203621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 497 aa AA seqDB search
MESALPYLNVVQQPLIFRLVSQQQHVTEFRVEQKISFHSLLNVLEDFMKACGEAKPNSFE
YEDEDGDRITVRSDEELNAMIDWNQHCYNHMCNSTNGLYYMTIYPKVGKTATRRNTLGLT
VDVNTPLHTNTNYSKTASHSSRKCSEGVETILSCENILQEDLQFLHVIGHGNGGTVHKAF
HTALKKTLAVKVISLDITLEVQRQILSEMDILFQCNSPYIISFYGAFFTENKISMCTEYM
DRSSLDNYGQIPSHVLAGIVVMIVKGLQYLLSLKIMHRDVKPSNILVNSKGQVKLCDFGV
SIQLVNSIAKTYVGTNAYMAPERIMGDEYGIHSDVWSLGLSLIEMSTGMFPYPLTDSQHC
IVPPIELLQYIVNEQYRYILQNDTENLNALVADFVNVIRTKYNIWLANKRNDWNEESTKT
QYNKLKIRLKDDIKNNIKQLESTIASKFKSNPKLLYKYINEKKSVKTQIRALEIDNGEII
NDQFALAKTKQMFSFCV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtgctttgccatacttaaatgtagtgcaacaacctttaatctttcgtttggtt
tcacagcagcaacatgtaactgaatttagagttgaacaaaaaatcagttttcactctctg
ctgaatgtgttagaggactttatgaaagcatgtggtgaagccaaaccaaattcatttgag
tatgaagatgaagatggagatcgaataactgttcgctctgatgaagagttaaatgctatg
attgattggaaccaacactgttataaccatatgtgtaatagtacaaatggactttattat
atgactatatatccaaaagtgggtaaaacagcaactcgaagaaatactttgggtcttaca
gttgatgtcaatacaccattgcataccaacacaaattattcaaaaactgcttcacacagc
agccgaaaatgttctgaaggagttgaaacaattctcagttgtgaaaatatattacaggaa
gatcttcaattcctacatgtcattggtcatggaaatggaggcactgttcacaaagcattt
cacactgcattgaaaaaaaccttagctgtgaaggttatatcattggatattactttggaa
gttcaacgccagattctttcagaaatggatattctttttcaatgcaactcaccttacatt
atttctttctatggggctttttttacagaaaacaaaatttcaatgtgtacagaatacatg
gataggagttctttagataactatggacaaataccttcacatgttttggcaggcattgtt
gtaatgattgtgaaggggctacaatatcttttgagtctgaagataatgcacagagatgta
aaacccagtaatattttagtaaattcaaaaggtcaagtgaaattatgtgactttggtgtc
agtatacaattggttaattctattgcaaaaacatatgttggtacaaatgcatacatggca
ccagaaagaattatgggtgatgaatatggaatacattcagatgtgtggagtttaggcctg
tctcttattgagatgtctactggaatgtttccatacccattgactgattcacagcactgc
atagtaccacctattgagttgcttcagtatattgttaatgagcaatatcgttatattctt
caaaatgacactgaaaatttaaacgcgcttgttgctgattttgtaaatgttataagaact
aaatacaatatatggcttgctaataaacgtaatgactggaatgaggaatcaacaaaaact
cagtataataagctaaaaattagattaaaggatgatattaagaacaatataaaacaatta
gaaagtactatagctagcaagtttaaatcaaatcctaaattgctttataaatatatcaat
gagaagaaatcagtgaaaactcaaattcgagccctggaaattgataatggggaaatcata
aatgatcaattcgctttagctaaaactaaacaaatgttttcattctgcgtatga

DBGET integrated database retrieval system