KEGG   Hydra vulgaris: 100203658Help
Entry
100203658         CDS       T01080                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
hmg  Hydra vulgaris
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100203658
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100203658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
TNLKRIVHFDLKGAPPKHSYFLKLLPLLKSLGASGLLIEYEDMFPYSGLLHQISSPFAYS
KVEIQELLDTAKKLNMEVIPLVQTFGHFEFVLKHEQFRYLRETPEYANLPCPLHNETLSM
VLKMVDQVLSVHPDITLIHLGGDEVFNLKDCARCKESGMQKEHIYLHHMVPILKYIEKKT
NLRVRPIIWDDMIRNWPLVEMQKLSNLTDIMVWGYGPNLDNHFPKDMWEKYLAAFKSLWL
ASSFKGALSPNNNIPPIPMHIKNHESWLRILEKNKVLETKISGIALTGWARYDHFATLKE
Y
NT seq 907 nt NT seq  +upstreamnt  +downstreamnt
gactaatttaaagcgaattgttcattttgatttgaagggtgcacctccaaaacattcata
ttttcttaaacttttgcctttacttaagtctcttggtgcttcaggtttattaatagaata
tgaagacatgtttccatactctggacttctgcaccaaatatcatccccttttgcatacag
caaagttgagattcaagaacttttggatacagctaaaaaattgaacatggaggtcatacc
acttgttcaaacatttggccattttgagtttgttcttaaacatgagcaatttcgatattt
aagagaaactcctgagtatgcaaatcttccatgcccgcttcataatgaaacattaagtat
ggtattgaagatggttgatcaagtgttatctgtgcatccagatattacattaatacacct
aggaggtgatgaggttttcaacttgaaagattgcgccagatgtaaagaaagtggcatgca
aaaggaacacatttatctccatcatatggtccctattttaaaatatattgaaaaaaagac
aaatctgcgtgtgagaccaataatttgggatgatatgataagaaactggcctttagtgga
gatgcaaaaattatcaaatctcacagatattatggtttggggttatggaccgaatttaga
caatcactttccaaaagatatgtgggaaaaatacttagcagcttttaaatctttatggtt
agctagttcatttaaaggtgcattatctcccaacaataacataccaccaatacctatgca
tataaaaaatcatgaatcttggctgcgaatactagagaaaaacaaggttctcgaaactaa
aatctctggaattgctttaacaggatgggcaaggtatgaccattttgcaacactgaagga
gtactaa

DBGET integrated database retrieval system