KEGG   Hydra vulgaris: 100203658Help
Entry
100203658         CDS       T01080                                 

Definition
hexosaminidase D-like
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
hmg  Hydra vulgaris
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:hmg00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 301 aa AA seqDB search
TNLKRIVHFDLKGAPPKHSYFLKLLPLLKSLGASGLLIEYEDMFPYSGLLHQISSPFAYS
KVEIQELLDTAKKLNMEVIPLVQTFGHFEFVLKHEQFRYLRETPEYANLPCPLHNETLSM
VLKMVDQVLSVHPDITLIHLGGDEVFNLKDCARCKESGMQKEHIYLHHMVPILKYIEKKT
NLRVRPIIWDDMIRNWPLVEMQKLSNLTDIMVWGYGPNLDNHFPKDMWEKYLAAFKSLWL
ASSFKGALSPNNNIPPIPMHIKNHESWLRILEKNKVLETKISGIALTGWARYDHFATLKE
Y
NT seq 907 nt NT seq  +upstreamnt  +downstreamnt
gactaatttaaagcgaattgttcattttgatttgaagggtgcacctccaaaacattcata
ttttcttaaacttttgcctttacttaagtctcttggtgcttcaggtttattaatagaata
tgaagacatgtttccatactctggacttctgcaccaaatatcatccccttttgcatacag
caaagttgagattcaagaacttttggatacagctaaaaaattgaacatggaggtcatacc
acttgttcaaacatttggccattttgagtttgttcttaaacatgagcaatttcgatattt
aagagaaactcctgagtatgcaaatcttccatgcccgcttcataatgaaacattaagtat
ggtattgaagatggttgatcaagtgttatctgtgcatccagatattacattaatacacct
aggaggtgatgaggttttcaacttgaaagattgcgccagatgtaaagaaagtggcatgca
aaaggaacacatttatctccatcatatggtccctattttaaaatatattgaaaaaaagac
aaatctgcgtgtgagaccaataatttgggatgatatgataagaaactggcctttagtgga
gatgcaaaaattatcaaatctcacagatattatggtttggggttatggaccgaatttaga
caatcactttccaaaagatatgtgggaaaaatacttagcagcttttaaatctttatggtt
agctagttcatttaaaggtgcattatctcccaacaataacataccaccaatacctatgca
tataaaaaatcatgaatcttggctgcgaatactagagaaaaacaaggttctcgaaactaa
aatctctggaattgctttaacaggatgggcaaggtatgaccattttgcaacactgaagga
gtactaa

DBGET integrated database retrieval system