KEGG   Hydra vulgaris: 100203678Help
Entry
100203678         CDS       T01080                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
hmg  Hydra vulgaris
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100203678
   04142 Lysosome
    100203678
Exosome [BR:hmg04147]
 Exosomal proteins
  Proteins found in most exosomes
   100203678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1623 aa AA seqDB search
MAQLLPIRFQEHLQLQNVGINAANIGFSTLTMESDKFICVREKVGEQAQVVIIDMADPNN
PTRRPISADSAIMNPASKVIALKAAKTLQIFNIEMKSKMKAHNLTEDVIFWKWISVNTLG
LVTEASVFHWTMEGDSSPVKMFDRHQSLAGCQIINYKVDHSGQWLLLVGISAQQNRVVGA
MQLYSIERKVTQPIEGHAAVFSQFKMEGNAQPSNIFCFAVRGATASKLHIIEVGTPPTGN
QPFPKKAENIFFPPEADKDFPVAMQASEKYGVLYLVTKYGYIHLYDVESAQCIYSNRISA
DTIFVTAPYEPTEGIIGVNRKGQVLSVSCDEEKMVPFLIQVKQNGELARRMAERCNLPGA
DNLFIQTFNEKFAIGQYPEAAKIAAKAPKGILRTPQTIQKFQQLPSQPGQTSPLLQYFGI
LLDQGQLNKYESVELCRPVLMQNRKQLMEKWLKEDKLDCSEELGDLAKQFDNTLALSVYL
RANVPNKIVDAFMEFNLVQNCTSFLLDALKNNRPSEGPLQTRLLEMNLLSAPQVADAILG
NQMVTHYDRAHIAQLCEQAGLLQRALEHYTDPYDIKRAIVHTHVLNPEWLVNYFGTLSVE
DSIECIRAMLTHNIRQNLQICVQIASKYYEQLTTSALIELFESFKSFEGLFYFLGSIVNF
SQEPDVHFKYIQAACKTGQMKEVERICRESNCYNAERVKNFLKEAKLTDQLPLIIVCDRF
DFVHDLVLYLYKNNLQKYIEIYVQKVNPSRLSVVVGGLLDVDCSEDIIKGLILSVKGQFS
TDELVAEVEKRNRLKLLLPWLESRIHEGSVEPATHNALAKIYIDANNNPERFLRENHFYD
SLVVGKYCEKRDPHLACVAYERGQCDLELINVCNVNSLFKSLARYLVRRRNPELWQGVLL
EDNKYRRQLIDQVVQTALSETQDPEDVSVTVKAFMTADLPNELIELLEKIVLENSVFSDH
RNLQNLLILTAIKADRTRVMEYITRLDNYDAPDIASIAIGSELFEEAFAIFKKFDVNTSA
IQVLIENIQNLDRAYEFAERCNDPAVWSILGKAQLTQGLVKEAIDSYTKADDPSDYKEVV
EASKMAGSYEDLVKYLQMARKKAKEAFIDTELIFAFAHTGRLADLEEFVSSPNHANIGQV
GERCFQEKMFEAAKILFNNISNFARLASTLVNLGAYQEAVDSARKANSTRTWREVCFSCV
DGKEFRLAQMCGLNIVVHADELEDLIKYYESRGYFEELITLMEAALSLERAHMGMFTELA
ILYSKYKTSKMKEHLELFWSRVNIPKVLRACEQANLWSELVFLYDKYEEFDNAVVTMMKH
PTVAWKEGLFKEVITKVANIELYYKALQFYLDHKPMLINDLLIVLTPRMDHTRGVSFFQK
AGHLPLVKPYLRSVQFHNNKAINEELNNLLIKEEDYNGLRASIDAFDNFDNIALAQKLER
HELIEFRRIGAYLYKGNNRWKQSVELCKKDHLYKDAMQFACESRDQSVAEDLLQWFLEVN
KTECFVATLFMCYDLLKPDVVLELAWKHNLIDFAMPYMIQVMREYLTKVDKLAEVSAKRE
EEHSTAPEAPIIGMDQLMITNGPAFLPPTAMYGINPGMPPGMMPPGMIPQAYQTMPPQYY
GGM
NT seq 4872 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcttttgcctattcgatttcaagaacatcttcagcttcaaaatgttggaatt
aacgctgctaatattggtttctcaacacttacaatggaatctgacaagtttatttgtgtt
agagaaaaagttggggaacaggctcaagttgttattattgatatggcagatccaaacaac
cctacacgaagaccaatatctgctgattcagctataatgaatccagcttccaaagtaatt
gctcttaaagctgcaaaaactcttcaaatctttaatattgaaatgaaaagcaaaatgaaa
gcccataacttaactgaagatgttattttttggaaatggatttctgtaaacacattaggt
ttagttacagaagcatcagtttttcattggacaatggaaggtgattctagccctgtaaaa
atgtttgatagacatcaatctcttgctggttgtcaaataattaactataaagtagaccat
tcaggccagtggttgctgttggttggtatatcagctcagcaaaatcgtgttgttggtgca
atgcaattgtattcaattgagagaaaagttacgcagccaattgaaggtcatgctgctgta
ttttctcaatttaaaatggaaggtaacgctcaaccatcaaatattttctgctttgcagtc
agaggagctactgcttcaaagctgcacatcattgaagtgggaactccaccgactggaaat
caaccttttcctaaaaaagctgaaaatatattttttccacctgaggctgataaagacttt
cctgttgctatgcaagccagtgagaaatatggtgttttatatcttgttactaaatatgga
tatattcatttatatgatgttgaaagtgctcaatgtatttattcaaatagaattagtgct
gatacaatctttgtgactgccccttatgagccaactgaaggaataattggtgtaaacaga
aaaggacaggttctctcagtttcttgcgacgaggaaaaaatggttccttttttaatacaa
gtcaagcagaatggtgagctagctcgtagaatggctgaacgctgtaatttgccaggagca
gataacttgtttattcaaacatttaatgaaaaatttgccattggacaatacccagaagcc
gcaaagattgcagctaaagcacctaagggaatattaagaaccccacaaacaatccaaaag
tttcaacaactaccttcacaacctggtcaaacatctcctttgttgcagtactttggtatt
ttattggatcaaggtcagttaaataagtatgaatcagttgaactatgtaggccagtttta
atgcaaaatcgtaaacaacttatggaaaagtggttgaaagaggacaagcttgactgtagt
gaagaactaggcgatcttgcaaagcagtttgacaacaccttagctttatctgtttattta
agagctaatgtccctaacaagattgtagatgcatttatggagttcaatttagtacagaac
tgtacatcattcttgttggatgccctcaaaaataacagaccaagtgaagggccgttgcag
acaagacttttggaaatgaacttattatcagctcctcaggttgctgatgctatattgggt
aatcaaatggttactcattatgatcgtgctcatattgcccaactttgcgaacaagctgga
cttcttcagcgagctcttgaacattacacagacccatatgatattaagcgagctattgtt
cacactcatgttctgaatcctgagtggttagttaactattttggaacgctgtctgtagaa
gattcaattgaatgtattagagcaatgcttacacataatataagacaaaatttacaaata
tgtgttcaaattgcttcaaagtattatgaacagctgactacatctgcattgattgagtta
tttgaatcgtttaagagttttgaagggttgttttatttcttaggatctattgtaaatttt
tcacaggaacctgatgtacactttaaatatatacaagctgcttgcaagacaggtcaaatg
aaagaagttgaacgtatttgtagagaaagtaactgttataatgcagagagagtgaaaaac
tttttaaaggaagctaaattaacagatcaacttccactcataattgtttgtgatcgtttt
gattttgttcatgatttagttttatatctttacaagaataacttgcagaaatatatagaa
atatatgtacaaaaagtaaacccgtctcgtttatcagtggttgttggtggtttgttagat
gttgattgtagtgaagatatcattaaaggtcttattttatcagtcaaaggtcaattttca
actgatgaacttgttgctgaagttgaaaaaagaaaccggttaaaattgttgttaccgtgg
cttgagtcaagaatacatgaaggctccgtagaaccagcaactcataatgcattagcaaag
atatatattgatgcaaataataatcctgagagatttttgagagagaaccacttttatgac
agtttggttgttggtaaatattgtgagaagcgtgatcctcatttggcttgtgttgcttat
gagcgtgggcagtgtgatttagaattaattaatgtttgtaatgttaactcattgtttaaa
agtcttgcaagatatttagttagaagaagaaatcctgaattatggcaaggcgttttatta
gaagacaacaaatatagaagacagttaattgatcaggttgtgcaaacagcgctttctgag
acacaagatcctgaagatgtatctgttactgtgaaggcgtttatgacagctgatctacct
aatgagcttattgaacttctagaaaagatcgtattagaaaattctgtgtttagtgatcat
agaaatcttcaaaacttgttaattttaactgccatcaaagcagatagaacacgggttatg
gaatacatcacacgtctagataactatgatgcacctgatattgctagtattgctataggt
agtgaactatttgaagaagcatttgctattttcaaaaagtttgatgttaatacatctgca
attcaagttctcattgaaaatattcaaaatctggatagagcttatgaatttgctgaaaga
tgcaatgatcctgctgtgtggagcatacttggtaaagctcaacttacccagggacttgtc
aaagaagctatagattcttacactaaagctgatgatccttcagattacaaggaggttgtt
gaagcttctaaaatggcaggaagttatgaagatcttgttaagtatttgcaaatggcacgt
aaaaaagcaaaagaagcatttattgataccgaactaatttttgcatttgctcatactggt
cgtttagctgatttagaagaatttgtatcaagtccaaatcatgctaatattggtcaagtt
ggtgagcgatgtttccaagaaaagatgtttgaggctgcaaaaattttatttaataatatt
tcaaactttgcaagattagcatcaacactagtgaatttaggggcgtatcaagaagctgtt
gacagtgctagaaaagctaatagtacccgaacgtggagagaggtatgtttctcctgtgtt
gatggcaaagaatttcgtcttgctcaaatgtgtggtttaaatattgtagttcacgcagat
gagttagaagatttaattaaatactatgaaagtcgaggttactttgaagaactgataaca
ctaatggaagcagcattgagtttagaaagagctcatatgggaatgtttactgaattggct
attctctattcaaaatataaaacaagtaaaatgaaagaacatcttgagttgttttggtca
cgtgttaatataccaaaggtgctacgtgcatgtgaacaagcaaatctttggtctgaactg
gtatttttatatgacaaatatgaggaatttgataacgctgttgtaacaatgatgaagcat
cccactgtagcatggaaagaaggactttttaaagaagttataactaaagtagccaatata
gaactatattataaagcattacaattttatttagaccataaaccaatgttaataaatgac
ttactaatagttcttactccacgaatggatcatacaagaggtgtaagtttttttcaaaaa
gctggacatctacctttagttaaaccttatttgcgttctgttcagtttcataataataaa
gctattaatgaggagttaaataacttattaattaaagaagaagattataatggtcttcgt
gcatcaattgatgcatttgataactttgacaatattgctctggctcagaagcttgaaaga
catgagttaatagaatttagaagaattggtgcatacttgtataaaggaaataacagatgg
aaacagagtgttgagttatgcaaaaaagatcacttatataaggatgctatgcagtttgct
tgcgaatctcgtgatcagtcagttgctgaagaccttctgcagtggtttttggaggttaat
aaaacagaatgctttgttgcaacattgtttatgtgttatgatttattaaaacctgatgtt
gtgttagaattagcatggaaacacaatctaattgattttgcaatgccgtacatgattcaa
gttatgcgagagtatctcactaaggtcgataaacttgctgaagtaagtgcaaagcgagag
gaggaacatagtactgctcctgaagctcctatcataggaatggatcaacttatgataact
aacggtccagcattcctgccgccaactgctatgtacggtattaatcctggaatgcctcct
ggaatgatgccgccaggaatgatccctcaagcatatcaaacaatgccaccacagtattat
ggaggaatgtaa

DBGET integrated database retrieval system