KEGG   Hydra vulgaris: 100203914Help
Entry
100203914         CDS       T01080                                 

Definition
(RefSeq) AP-2 complex subunit beta-like
  KO
K11825  
AP-2 complex subunit beta-1
Organism
hmg  Hydra vulgaris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100203914
Membrane trafficking [BR:hmg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    100203914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 935 aa AA seqDB search
MTDSKYFTTTKKGEIYELKAELNQHKTDRKKEAVKKVIAIMTVGKDVSALFPDVINCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNTFAKDCDDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINSTLVEDQGFLELLRDLLSDSNPMVVANA
VASLTEIAESSPNANQYFEMNSATINKLLTALNECTEWGQIFILDSLANYTPRDDKEAQS
ICERVTPRLSHANAAVVLSAVKVLMKLMEMMPAGSPFLQSLSKKLAPPLVTLLSSEPEVQ
YVALRNINLIVQKRPDILKQEIKAFFVKYNDPIYVKLEKLDIMIRLASQQNIAQVLAELK
EYATEVDVDFVRKSVRAIGRCAIKVEQSAEKCVTTLLDLIQNKVNYVVQEAIVVLKDIFR
RYPNKYESIISTLCENLDSLDEPEARASMIWIIGEYAERIDNADELLTTFLDGFSDENTQ
VQLQLLTAIVKLFLKRPTDTQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPAAAKD
VVLAEKPLISEETDLLEPTLLDELICHISTLASVYHRPPSSFVAGKTAGRRTILLSSSTN
DLDDVSETEQPAISQVANQTINQSASQPSSLLGDLLDMEPPAPPPTQKYTGMPTQVKPTS
DSVLDLLGGDLNMLSTPSPFIPQQPGPVTGLNDLFTLQTALPGSGYSAPKQVWLPAAKGK
GFEISGTFSRRLGQPYMDLTLSNRAMQPMGGFAIQFNKNSFGLTPAVLNVPAPLLPNQST
EVSLALGLAGGVMKMEPINNLQVAVKNNIDVFYFSCLIPAHILFVEDGQMERKLFLGTWK
DIPQTSEVQTSFPTKGLSSEHYQFLLQANNIFTVAKNNVDGQEMLYQSMKFCNNLHVLSE
LKIIPGNPVVQLALKTRAMDVVPIVQAVYKQLLQL
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgactgactcaaagtattttaccactactaagaaaggtgaaatttatgagctgaaggca
gagttaaatcaacataaaactgatcgtaaaaaagaagctgtaaaaaaagttattgctata
atgacagttggaaaagatgttagtgcattatttccggatgtaataaattgtatgcaaaca
gacaatctagagctaaagaagcttgtgtatttatatttaatgaattatgcaaagtctcaa
cctgatatggcaattatggctgtcaatacatttgcaaaggattgtgatgatcctaatcca
ttgattagagcattagctgtcagaaccatgggttgcattagggtagataaaataacagag
tatttgtgtgaaccattgcgaaaatgcttaaaagatgaagatccatatgttagaaaaact
gcagcagtttgtgttgccaagttgcacgatataaactctactcttgttgaagatcaagga
tttttagagctgctgagagacttactctcagattctaacccaatggttgttgcaaatgct
gtcgcatcattaacagaaattgcagagtcatctcctaatgcaaatcaatactttgaaatg
aattctgcaacaataaacaaactccttacagcattaaatgaatgcactgagtggggtcag
atatttattctagattctcttgctaattacacaccacgagatgataaggaggcacaaagt
atttgtgaacgtgtgaccccacgtttatctcatgccaatgctgctgttgttctttctgct
gttaaagttttaatgaaacttatggaaatgatgcctgcaggatctccatttcttcaaagt
ctttccaaaaagctagctccgccacttgtaactcttctttcttctgagcctgaagtacaa
tatgttgctctaagaaatattaatttgattgtgcagaaaagacctgatatcttgaaacag
gaaattaaagctttctttgtgaaatacaacgatccgatatatgttaaacttgaaaaactt
gatataatgatcagattggcatcccaacaaaatattgctcaagtcttagctgaacttaag
gaatatgctacagaagtagatgttgattttgtgcgtaaatctgttagagctattggaaga
tgtgctatcaaagtggaacaatcagctgaaaaatgtgttacaacattattggatttaatt
caaaacaaggtcaattatgttgttcaagaagccattgtggttttaaaggacatatttcga
agataccctaataaatatgagagtattatttcaacactttgtgaaaaccttgattcatta
gatgaaccagaagccagagcttctatgatatggatcattggagagtatgctgaacgtatt
gataatgctgacgaacttcttaccacatttcttgatggtttttctgatgaaaatactcaa
gtacagctgcagttactcacagcaattgtcaagttatttttaaagagaccaactgatact
caagaacttgtacagcaagttcttagtcttgcaacccaggatagtgataatccagatctc
agggatcgtggttatatatattggaggttgctttccactgacccagcagctgcaaaggat
gttgtgctagcagaaaaaccattaatctctgaagagacagatttgttagaaccaacgcta
cttgatgagctgatttgtcacatttctactcttgcatcagtttaccatagacctcctagc
tcatttgttgcgggtaaaacagcaggtcgtcgcactattcttctatcatcttcaactaat
gatttggacgatgtatcggaaactgagcaacctgcaatttcccaggttgccaatcaaact
ataaatcaatcggcttctcaaccctcttctttattaggtgatcttttagatatggagcca
cctgctcctccaccaactcaaaaatacactggaatgccaacacaagtcaaacctacctca
gattcagttcttgatctcttggggggtgatctaaatatgcttagcacaccatcacctttt
attccgcaacaacctggtcctgtgactggacttaacgatctttttactttacaaactgct
cttcctggctcaggttattcagctcccaaacaggtttggttaccagcagcaaaaggaaaa
gggtttgagatatcaggtactttttcaagacgccttggtcaaccatacatggatttaaca
cttagtaatcgcgcaatgcagccaatgggaggttttgcaatacaatttaataaaaacagt
tttggtttgactcctgctgttcttaatgttccagcaccactacttcctaatcaatcaact
gaagtttcacttgcacttggattggctggtggtgttatgaaaatggaaccaattaacaat
ttgcaagtggctgtaaaaaataacattgatgtattctactttagctgtctaattccagct
catatattgtttgttgaagatggccaaatggaacgcaaactatttttgggtacgtggaaa
gatattccccaaacaagcgaggttcaaactagttttcctactaaaggactttcttctgaa
cactaccaatttcttctgcaagcaaataatatttttacagtagctaaaaataacgtcgat
ggacaggagatgttgtatcagtcaatgaagttttgcaataatttgcatgttttatctgaa
ctgaaaattatacctggcaatcctgttgttcaactggctttgaagacacgcgccatggat
gttgttccaatagtacaagcagtatataaacagttgttgcagttgtag

DBGET integrated database retrieval system