KEGG   Hydra vulgaris: 100203970Help
Entry
100203970         CDS       T01080                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hmg  Hydra vulgaris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hmg00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MQRQKKGRLDVQLKKSVVLSSDDKDVYTEDFNNNSLHKETDFNIQNSIIQQQSENQWFKN
GVETIKKKLRVKKINKKAKNVILFIGDGMGPSTVTAARILDGQKKKKKGEENVLSWEEFD
NVALSKTYNVDAQVPDSAGTATAFMSGVKTNMGTINVNENVTYKDCASSIGNEVLSLAQY
AELAGLSTGVVTTTRLTHATPATVYASSASRNWEHDKTVNDSRCKDIASQLIDNKYGDGL
EIAFGGGRCSFLPVTTKDHTATSYGLRGDGRNLLEEWEKKTNQNAKYEYVTNASQLKSLK
PNEVDHLLGVFSYDHMNYSHYRLNGTDEPSLVEMVEFAVKVLSKNSKGYFLLVEGGRIDH
GHHANKAFHALHDTVELNDAVHKAKEITDSDETLLIVTADHSHVFTIGGYQSRGNPIFGL
VNNENDVALDKKRYSTLGYSNGPSGKINGKRKNITQADLNDPDSRYQSLVPLKDETHGGE
DVGIYARGPQAHLVSGVVEQNYIFHVMDYALCLTEEKKYICKQEGLI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcagagacaaaaaaaggggcgtctagatgttcagctcaaaaaaagtgttgttttatct
tctgatgataaagatgtatataccgaagattttaacaataattcattgcataaagagact
gacttcaatattcaaaatagtataattcagcaacaatcagaaaaccagtggtttaaaaat
ggtgtagaaacaataaaaaagaaattaagagtaaagaaaataaataaaaaagctaaaaat
gtcattttatttattggtgatggtatgggaccttcaacagtaacagctgctcgtatactt
gatgggcaaaagaaaaaaaagaaaggtgaagaaaatgttctaagctgggaagagtttgat
aatgttgctctatcaaaaacttacaatgttgatgctcaagttcctgattctgcgggcact
gcaacagcattcatgtcaggagtaaaaacaaatatgggtaccattaatgtgaatgagaat
gttacatataaagattgtgcatcatctattggtaatgaagttttgtcactggcacagtat
gcagagttagctggattatcaactggtgtagttactacaacacgtctaacacatgcaact
ccagctacagtttatgcaagttctgcctctagaaattgggaacatgacaaaactgttaac
gattctcgatgcaaagatatagcaagccaactgattgataacaagtatggagatggtctt
gaaattgcttttgggggaggacgctgttctttccttcctgtaacaactaaagatcataca
gcaacttcatatggcttaagaggagatggtagaaatcttcttgaagaatgggagaaaaaa
acgaatcaaaatgcaaaatatgaatatgtgacaaacgcttctcaattaaaaagtttaaaa
ccaaatgaagttgatcatttgctcggagttttcagctatgatcacatgaactattctcat
tatcgattaaatggaactgatgagccttcattagttgaaatggttgagtttgctgttaaa
gtactcagtaaaaattcaaaaggatactttttattagttgaaggtggtcgaattgatcac
gggcatcatgcaaacaaagcatttcatgctcttcatgatacagtagaattaaatgatgct
gttcataaagcaaaagagattactgattcagatgagactctccttatagttacagctgat
cactcacatgtatttacaataggagggtatcaaagtcgtggcaatcccattttcggtttg
gtcaacaatgagaatgatgttgcgcttgacaaaaaacgatactcaactctaggctattct
aacggacctagtggtaagattaatggaaaaagaaagaatattactcaagctgatcttaat
gatccagattctagatatcaaagcttggtacctctaaaagatgaaacccatggaggagaa
gatgttggtatttacgctcgtggacctcaggcgcatttagtttcaggagttgttgagcaa
aactatatatttcacgttatggactatgcactttgtttgactgaagaaaagaagtacata
tgtaaacaagaaggattaatttaa

DBGET integrated database retrieval system