KEGG   Hydra vulgaris: 100204319Help
Entry
100204319         CDS       T01080                                 

Definition
uncharacterized LOC100204319
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100204319
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: Other group
  TTK family
   100204319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 772 aa AA seqDB search
MDIKFQIKKIIENGSKDTDWLCFIDQVKKKCDRDILQGLYLAAFSNISQNKSKSFKKLLV
GFANLQSDIAPEIARKTFLNVNSLDDECAVVCVYYAQFEYRHNKDNARNIIVKGKCDGRI
PKVLLTQAYRNIKNNNANLFEGINDPWDEALCDMTDTATFTTSKASPENQDSHLFYSSKS
LSSFPTRLPVRSVQKTQSTSALIKGTNSPSNNFKRHDLSKLSSDDHKHTRRHGPSLSPFF
ERDSSKLFEFQSSTAKIIESTPYDLFNCSQSTNNLVFEAPITINTKCSEQTENSSLPSEC
RISTHETNKLENNNVHHSKNKLLMRRSIACSGLVCNEQTLTEDAKNKNIVCIKESIQNLD
HCNERVPLPVLHENSNFDIVSSCSGLVCNEQTLTKDAKNENLVCSKESIQNLDHCNERVL
LPVLHENSNFDIVSSSCSVLACNKQTLTEDAKNVNLVCTKESIQYLNHLNQRAPLSVLHE
NSNFDIVSSSSLSSLVLNIANNQPESCFKLSESIPIEHQLQKVFEVQSETGETFALKRVN
FEELDSCTLDLYLSEIKWLEKFKDSPHIIRIFDWENTNSSLLIVMEKGDTDLGNILRTEK
FLSIEKLKDFWKQMLSAVLAIHRVGVVHADLKPANFLLVGDKLKLIDFGIANGIQANKTS
ITRELLMGTLNYMPPEALNPDINHVNGAAKISCESDVWSLGCILYMMVFKKTPYQHIRNQ
NAKMLAIQRGEEINFSGIRDQNLLHCLKVCLKYDKRERQSVEELLQHPFLQP
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggacattaagtttcaaattaaaaaaataattgaaaatggaagtaaagatactgactgg
ctttgttttattgatcaagttaaaaagaaatgtgatcgtgatattttacaaggtttatat
ttagctgcatttagtaatatatcccaaaataaatcaaaaagtttcaagaagttgcttgtt
ggttttgctaatcttcaaagtgatattgctccagaaattgcccgaaaaacatttcttaat
gtgaattctttagacgacgaatgtgctgtagtttgtgtttactatgctcaatttgaatat
agacacaataaagataatgctcgaaatattattgttaagggaaaatgtgatggtcgaata
ccaaaggttcttttgactcaagcatatcgaaacataaaaaacaataatgcaaatttattt
gaggggattaatgatccatgggatgaagcgttatgtgatatgacagatacagctactttt
actacatctaaagcttctccagagaatcaagattcacatttattttattcgtctaaaagt
ttatcttcatttcctactcgattaccagttaggtcagtacaaaaaacacaatcaacctct
gctttgattaaaggaaccaatagcccatccaataattttaaaaggcatgacttgtcaaaa
ttgagttctgatgatcataagcatacaagaagacatggtccaagtttatcaccttttttt
gaaagagactcatcaaaacttttcgaatttcaatcttcaactgctaaaattatagagagt
acaccatatgatctttttaattgtagccaatctactaataatttagttttcgaagcaccc
attacaataaacacaaaatgctctgagcagactgaaaactcaagcttaccatctgaatgc
cgaatatctactcatgaaactaataaacttgaaaataacaatgtccatcattcaaaaaac
aagttgttaatgcgacgttctattgcatgcagtggtttagtttgcaatgaacagacactt
actgaagatgcaaaaaataaaaatatagtttgtattaaagaatctattcaaaatttggat
cattgcaatgaaagagtcccattaccagttttacatgaaaatagtaattttgatatagta
tcttcctgcagtggtttagtttgtaatgaacagacacttactaaagatgcaaaaaatgaa
aatttagtttgttctaaagaatctattcaaaatttggatcattgcaatgaaagagtccta
ttaccagttttacatgaaaatagtaattttgatatagtatcttcttcctgcagtgtttta
gcttgcaataaacagacacttactgaagatgcaaaaaatgttaatttagtttgtactaaa
gaatctattcaatatttgaatcacctcaatcaaagagccccgttatcagttttacatgaa
aatagtaattttgatatagtatcttcttcttccttgtcttctttagttttgaatatagca
aataaccaaccagaatcttgtttcaagctcagtgaaagtattccaattgaacatcagcta
caaaaagtttttgaagtacaaagtgaaactggcgagacatttgctttaaaaagagtgaac
ttcgaagaacttgattcctgtacattagatctttacttaagtgaaataaaatggttggaa
aagttcaaagatagtcctcatattatacgaatctttgattgggaaaatacaaatagttcg
ttattaattgtaatggaaaaaggtgatacagatcttggaaatatacttcggactgaaaaa
tttttatctattgaaaagttgaaagatttctggaaacaaatgctatctgcagtccttgca
attcatcgtgttggtgttgtccatgctgacctaaaacctgcaaattttttgcttgttggt
gataaactcaagctcattgactttgggatagccaatgggattcaggcaaataaaacaagt
ataactagagagttactgatgggaacattaaattacatgccacctgaggctcttaatcct
gacatcaaccatgttaatggtgctgcaaagatatcttgtgaatccgatgtttggagtttg
ggatgtatactttatatgatggtatttaagaaaacaccttaccagcatattcgaaaccaa
aatgcaaaaatgttagccatacaacgaggtgaagaaataaatttttcaggaatacgagat
caaaaccttttacactgcttaaaggtctgtctaaaatatgataaacgtgaaagacagtca
gtggaagaacttctacagcatccttttctacaaccttaa

DBGET integrated database retrieval system