KEGG   Hydra vulgaris: 100204442Help
Entry
100204442         CDS       T01080                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
hmg  Hydra vulgaris
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hmg01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:hmg00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hmg04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 215 aa AA seqDB search
MDMKHIYLIVDIFLACALCTISSNLITNKTIPVVIWHGMGDSCCNPLSMGSIKKMIETKI
PNIYVLSLMIGNNIIEDTENGFLLNSNTQVEQVCQKLLSDTNLKNGYNALGFSQGAQFLR
AVAQRCPFPPMKNLISFGGQHQGVYGFPRCPGESLKLCDYMRKLLNFGAYVSWVQEHLVQ
AQYWHDPIKEEEYREKSLFLADINQELVIIKSFLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggatatgaaacatatatacttgatagtagatatttttctcgcttgcgcattatgcacc
atatcatcgaatttgattacaaacaaaactattccagttgtaatatggcacggaatgggt
gattcttgttgcaatcctttaagtatgggaagcataaagaaaatgatagaaacaaagatt
ccaaacatttatgtactttcattaatgattggaaataatattattgaggatactgaaaat
ggttttctcttaaactcaaacactcaagttgaacaagtttgtcaaaaacttttgtctgac
acaaacttaaaaaatggatacaatgctttaggattttctcagggcgcgcagtttttgcga
gcagttgctcagagatgcccatttccaccaatgaaaaatttgatttcttttggaggtcaa
catcagggtgtatacggttttccacgttgtcctggtgaatcattaaagttgtgtgattat
atgcgtaaacttttaaactttggagcatatgtaagctgggttcaagagcatcttgttcaa
gctcaatattggcatgatccaataaaagaagaagaatatagagagaaaagtctatttctg
gctgatattaaccaagaattggtaattattaaatcttttttattg

DBGET integrated database retrieval system