KEGG   Hydra vulgaris: 100204516Help
Entry
100204516         CDS       T01080                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H2-like
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
hmg  Hydra vulgaris
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100204516
Enzymes [BR:hmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100204516
Chromosome [BR:hmg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100204516
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100204516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 327 aa AA seqDB search
MGKPKPKKDKPLLACKVVVLEDVNQLAKKYRGKFQLTLKTIKKKGYENCIDPAQNMLLVQ
WETLLNKICHEDPVIAVENFVDNEGPPDNFTYVRQNITHGLANDLLDPNFLAGCECFPRC
SQNTCSCPKNSGHKFAYDRNKRVLLPPQSPIYECNKRCKCGDDCPNRVLQKGLTVRVCIF
RTDNGRGWGLKTREFIPKDMFVVEYVGEVITSDDAERRGKLYDERQQTYLFDLDFNGDPT
FTIDAHEYGNVSHFINHSCDPNLRVFTVWVDTLDPRLPRLGLFALRDIKQGEELTFDYTC
GQKESKTSNEIKMYCACGAPNCRKYLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacccaagccaaagaaagataaaccattgctagcttgcaaagttgtagtttta
gaagatgtcaatcaattagctaaaaaatatagagggaaattccaattaactctgaaaaca
attaaaaaaaaaggttatgaaaattgcattgatccagcccaaaacatgctgttagttcaa
tgggagactcttctcaataaaatatgtcatgaagatccagttattgctgttgaaaacttt
gtcgataatgaaggtccaccagataattttacttatgttagacaaaacattactcatgga
ttagctaatgatttacttgatcctaattttttagctggttgtgaatgttttccgcgatgc
tctcaaaatacttgttcttgtcccaaaaatagtggacataagtttgcatatgatagaaac
aaaagagttttacttcctccacaatctccaatttatgaatgcaataaacgatgcaagtgt
ggtgatgattgtccaaaccgagtcttacaaaaaggattaacagttagggtttgcatattt
agaactgataatggcagagggtggggtttaaagacaagagaattcattcccaaagatatg
tttgtggttgagtatgttggcgaagtaatcacaagtgatgatgcagaaagaagaggaaag
ctatatgatgaacgccagcaaacttatttatttgacttagattttaatggagatccaaca
tttactatagatgctcatgaatatggaaatgtttcacattttatcaatcattcctgcgat
ccgaatcttcgtgtttttacagtatgggtggatacccttgatcctcgtctacctcgtttg
gggttatttgctcttcgcgacataaaacagggagaagagttaacattcgattacacttgt
ggacaaaaggagtcaaaaacatctaacgaaattaaaatgtactgtgcttgcggcgcacct
aattgtagaaaatatttgttttaa

DBGET integrated database retrieval system