KEGG   Hydra vulgaris: 100204838Help
Entry
100204838         CDS       T01080                                 

Definition
filamin-A-like
Orthology
K04437  
filamin
Organism
hmg  Hydra vulgaris
Brite
Exosome [BR:hmg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100204838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1141 aa AA seqDB search
MENVTKKAVVGSEEDWIEMQNNTFTNWVNANLKQRGMSVESIAFGFEDGVKLVNLYEIVA
KRSLGKYAKNPKFPNQKLENVSLVLKAMQQDGVKLVSIDSDHVVNCNFKMILGLIWQLIL
RYQISGTEDKSIKIALKKLLLVWLQHVIPEQNITNLTNDWNNGIALCNLINVLHPGSFPE
YNNLRQEDAFSNACRGMKLAEDMFNIPQIISAENMINKNVDELSMITYLSYFTKDNGIGV
LWTLNLVNKWNSSIGVKNFNKDWNDGSAIRNLINTFQPNLVPEPISNDNEENCKTAMAIA
EKVFLIPQIISPSEMANPKIPELAIMAYVVQFTKVKPIIIPSTKFSLSGAGIVEPKVGAI
NEFYIRCSDDTLEMDELEVEIIGPNLVPINFKYDINNPLLRTYKYNAEEQGIYRISVMYL
GNHVPQSPVITIAKQDLEIIKVRGEGLSGGHLHSPVIFIVDVGAANSQVEVNIEGPDGKL
VKNIVKNNKDGTYTVKYTPLVEGIHLIDLTVNRQKLPGGPIKTMITDLGSVTVTAKQYEI
DKQLYAELHERIGIAVDTSSSGVGTLTAETKGPNKKPVETDIENDGNDSYTVSFTPNIVG
EFYTNVYWNGKKIQGCPFVVWVSDCTKVKTCGEPLKYTNIHEETFFNITTFGAGPGNLTG
YIEKEGFQIPLNISMKDINTYACSFRANEVGEHNVCIYYNNVSIHGNPHKVNVCNPKKVV
VVKGTDSNVLLLNQPHSLEIELGVGAGLGELSCSVIGPVGEIPSSIKELTYNRKEIRFVP
VIPGSYEVKVFYCQRLITGSPYTFKVYPIAPEHLLNEKEENQISKVDPSKVTISTSFLEA
IVDEPSRLTVNPKYAGPGHLSATFQGENNTNIVVGIRDNNNGTYEVTYTPPSSGKYVLNL
YWDDQHIPGSPFNVVARKKEEEEKFILKGNGIREGTAGQPVLFTLDGRRAGHGKLSCKCR
APSGKMTYVLISDNKDGTYTVDLNATEPGLHTVEVEWDNRPITGSPFLVRIMQATDAKKV
KARGPGLESGILANFQGNFKVDSKGAGPGTLKIRIHGPKGAFKVEMFRESDHDRLVTVRY
NPTERGIYTANVFWSDEHITGSPFEIFVAENEKELRLWKENKEHAQKQADAKKQQNLLTT
G
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtaacaaaaaaggctgttgtaggatcagaagaagattggatagaaatgcaa
aacaatacgtttacaaattgggtaaatgcaaatcttaaacaacgtggtatgtctgtggaa
agcattgcttttggctttgaagatggagtaaaactagtgaatttatatgaaattgtagca
aagagaagtcttggtaaatatgcaaagaacccaaagtttcctaaccagaagcttgaaaat
gtttctttagtgcttaaagctatgcagcaggatggagtgaaacttgtaagtattgacagc
gaccacgtggttaattgtaattttaaaatgatcttgggtttaatatggcagcttatcctt
aggtatcaaatcagcggtacagaagataaaagcataaaaattgcattaaaaaaacttctt
ttagtatggcttcagcatgtcattccagaacaaaatattaccaacttaactaatgattgg
aataatggaatagctttatgtaatctaataaatgttttacatcctggatcattcccagag
tacaacaacttgcgccaagaagatgctttttcaaatgcatgtagaggaatgaaattagct
gaagatatgtttaatattccacaaattataagtgcggaaaacatgataaacaaaaatgtc
gacgagttaagcatgataacttacttgtcttatttcacaaaagataatggtattggagta
ctatggactttaaatctagtcaataagtggaacagtagtataggtgtaaaaaactttaac
aaagattggaatgacggcagtgcgatcagaaacttaataaacacattccagccaaatctg
gttccagaacctatttcaaatgataacgaggaaaactgtaaaaccgctatggcaatagca
gaaaaagtatttttaataccacaaattatatctccatctgaaatggcaaaccctaaaatt
ccagagctagctattatggcttatgtcgtacagtttacaaaggtaaaaccaattataatt
ccgtcaacaaaattttctttatcgggtgctgggattgttgagccaaaagttggtgctata
aacgaattttatattcgttgcagtgatgacactttggaaatggatgaattagaggtggag
attattggaccaaatttagttcctatcaattttaaatatgatattaataatcctctttta
aggacgtataaatacaatgcagaagaacaaggaatctaccgaatatctgttatgtatcta
ggaaatcatgtacctcaaagccctgtcatcacaattgcgaagcaagatctagagataatt
aaagtgcgcggagaaggattatcaggaggtcatctacattctccagtcatatttattgtt
gatgttggagcagctaattcccaggttgaagttaatattgaagggccagatggaaaactt
gttaaaaatattgttaaaaacaataaagatggcacttacactgtcaagtataccccactg
gttgaaggaattcacctcattgatttaactgttaacagacaaaaattacctggtggacca
attaaaaccatgattactgatcttggatcagtgacagtcacagcaaaacagtatgaaata
gataaacaactatacgcagagcttcatgaacgaattggaatagctgttgacacctcatct
tcaggtgtaggaacattaactgctgaaactaaaggacctaacaagaagccagtagagaca
gatattgaaaatgatggaaatgacagctatacagtttcatttactccaaatattgtagga
gaattttatacgaatgtatattggaatggaaaaaaaattcagggatgtccatttgttgtt
tgggtaagcgattgtacgaaagtgaaaacttgtggagaacctttgaagtatactaatatt
catgaagaaacattttttaatattacaacttttggagctggtcctggtaatttgactgga
tacatagaaaaagaaggctttcaaataccactgaatatttctatgaaagatattaataca
tatgcttgcagttttcgtgcaaatgaagttggtgaacataatgtttgtatttattataat
aatgtttctatacatggaaatccacataaagtcaatgtttgtaatccaaaaaaagttgtt
gttgttaaagggactgattctaatgttttattgcttaaccaacctcactctctggaaatt
gaattaggagttggtgctgggttaggggaacttagttgttctgtcataggtccagttgga
gaaattccctcttcaattaaagaactaacttataacagaaaggaaatcaggtttgtacca
gtaataccaggaagttatgaagtcaaagttttttattgtcaaaggttaattacaggctct
ccatatactttcaaagtttatcctattgcaccagagcatttattaaatgaaaaagaagaa
aatcaaatttccaaggtagatcctagtaaagttacgataagcactagctttctggaagca
atagtagatgaacctagtcgtttaactgtcaacccgaaatatgctggacctggtcattta
agtgccacctttcaaggagaaaataacactaatattgtagtaggtattcgagataacaat
aatggaacctatgaggtcacttatacaccaccttcttctgggaaatatgttttaaatctt
tactgggacgatcaacacattccaggtagtccgtttaatgtagtagcaaggaaaaaagaa
gaggaagaaaagttcattcttaaaggcaatggtattagagaaggtacagctgggcaacct
gttctttttacacttgacgggagaagagcgggacacggaaaactaagttgcaaatgtcga
gcaccatctggaaaaatgacttatgttcttatatctgataataaagacggaacatacact
gttgacttgaatgcaacagagcctggtttgcatacagttgaagtagaatgggacaatcgt
cctataacaggatcgccgtttcttgtaagaattatgcaggctactgacgccaaaaaagtt
aaagctcgaggacctggtttagagtctggaatattagctaattttcaaggtaattttaaa
gttgattcaaaaggagcaggtcccggaacacttaaaattagaattcacggaccaaaaggt
gcttttaaagttgaaatgtttcgcgaaagtgaccatgatcgccttgttacagtccgttat
aatccaactgagcgaggaatttatacggcaaatgttttttggtctgacgagcacattaca
ggaagcccttttgaaatttttgtggcggaaaatgaaaaagaattaaggttatggaaagaa
aataaagaacacgcgcaaaaacaagctgatgccaaaaaacaacagaatttattgaccact
ggataa

DBGET integrated database retrieval system