KEGG   Hydra vulgaris: 100205226Help
Entry
100205226         CDS       T01080                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase-like
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
hmg  Hydra vulgaris
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100205226
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100205226
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100205226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 970 aa AA seqDB search
MTSKSDLKRHIPPLYGWRVNLDHEFSEKPKVFVFPRLSQARKLAGMAFRYMKFTRKVKKK
GKLPFIDPYAVSACKQIYGVPLGGIGAGSIGRGWKGDFNRWQLRPGIYTYDTVDVNQFTV
CIRKCGKTIYQQVLAPYYPVAIKNVESLQSWTWSFDGGRGYYHALYPRAWTVYHITEHNI
KLTCRQVSPIFPDNYKDTSLPVGVFVWTIENIGMHDLDVSIMLTFQNGDGTNEDCVGGHN
NEEFFCKGVYSEIRLQKDESNASFKIKNLLNGFTRSDNVKVQANQYPNSFDDSFVVLSDS
DDDVTHFEPKIDVCHIFENKTCASQKLCHNNDSKNSSAVDIDINLVDLPKDDQKVSEKKI
ENCCNNLMTNSDNNFLLHEMCEIHNVRGVLMKHNALKKRFTLAIAALQVIHNTIDVVQVS
TKVAFDAQSPAAELWEDLNDDGVLDNKRGDSCYSYPGQLLAAAVAAKTTVHAGAKQDLKF
VLSWDQPFVTFGSDSGLSYCRRYTRFFGSNGNASPSLCCYALQNIDFWEDNIERWQNPIL
NDSELPAWFKSALFNELYFISDGGTVWLDIKRKKDSHGNFISDLVKLYGRFAYLEGHEYR
MYNTYDVHFYASWALALLWPNLQISMQYDICNSVLNVDDEKRPIMMEGGIAPRKVIGCVP
HDLGDPDDEPFVRVNAYCIHDTSQWKDLNLHFVLQVYRDFYITKNKQFLMDMWPAMKAAM
AHSLAQDIDGDGIIENSGIADSTFDTWVVTGPSAYTGGLWLSALRCIIEIAHILGLSQSI
SKYKSILERGKKSYEKKLWNGTYYNYDGSENDYHNCIMAGQCAGQWYLHACDLGQTEDDL
VFRPEQVHSTLKVIFQNNVMRFEDGFMGAVNGMRADGTVDKNSLQAEEVWTGVTYALAAT
MIQHGMVREGFRTAEGIYRTVYEKWGLGFQTPEAITANKTFRSRGYMRPLSIWSIYHAYS
KRVNSHKGES
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaagtctgatttaaaaagacatatcccaccgctatatggttggcgggttaat
cttgatcatgagttttcagaaaaacccaaagtgtttgtgtttccacgactgtcacaagca
agaaagcttgcagggatggcattcagatacatgaagtttactcgaaaagtcaagaaaaaa
ggaaaattgccatttattgatccttatgctgtttctgcttgcaagcaaatatatggtgta
cctttgggaggtattggagctggttctattggtaggggatggaaaggtgattttaacagg
tggcaactaagacctggaatatacacttatgatactgtggatgttaatcagtttaccgtt
tgcataagaaaatgtggaaaaacaatttatcagcaagttttagctccttattatcctgtt
gcaataaaaaatgttgaaagcttgcaatcctggacatggtcttttgatggtggaagagga
tattatcatgctttatatccacgtgcgtggactgtgtatcatattacagaacataatatt
aagttaacttgtcgacaagtttctccgatttttccagacaattacaaggatactagttta
cctgttggtgtttttgtttggacaatagagaatattggaatgcatgatcttgatgtctct
attatgctgacatttcaaaatggtgatgggacaaatgaagattgcgtcgggggtcataac
aatgaagagttcttttgtaaaggtgtttatagtgagatacgtttgcaaaaggatgaaagt
aatgcttcttttaaaataaaaaatctattaaatggtttcacaagatcagacaatgttaaa
gtacaggccaatcaatacccaaattcctttgatgatagttttgtagttctttctgacagt
gatgatgatgtcactcattttgagccaaagattgatgtttgtcatatttttgagaataaa
acttgtgcttcacaaaaattatgtcataataatgacagtaaaaattcaagcgctgttgat
attgatataaatttggtagatttacctaaagacgatcagaaagtgtctgaaaaaaaaatc
gaaaattgctgtaacaatttaatgacaaattctgataataactttttacttcatgaaatg
tgtgaaatacataatgtacgtggtgttttaatgaaacataatgctctcaaaaaacgtttt
actcttgcaatcgcagctttgcaagttatacataatacaatagatgttgttcaagtgagt
acaaaggttgcttttgatgcccaatcacctgctgctgaactgtgggaagatcttaatgat
gatggtgttttagataacaaaagaggtgatagctgctattcttatcctgggcaattattg
gcagcagctgtagctgctaaaacaactgttcatgccggagcaaagcaagatttgaaattt
gttttatcatgggatcaaccatttgttacttttggatcagatagtggattaagttattgc
agacgatatacacgtttttttggttcaaatggaaacgcttcaccttccttatgttgctat
gcattacaaaatatagatttttgggaagataatattgaacgctggcaaaatccaattctt
aatgatagtgaacttcctgcatggtttaaatctgctttgtttaatgaactatattttatc
agtgatggaggaactgtatggcttgatataaaacgaaaaaaagactcgcatggaaacttt
atttcagatttagtaaaactttatggcaggtttgcatacctagaaggtcatgagtatcga
atgtacaatacatatgatgttcatttttatgcatcatgggcacttgctttgctgtggcct
aatcttcagattagcatgcagtatgacatatgtaacagtgtgcttaacgtagatgatgaa
aaacgacccataatgatggaaggtggaattgcacctagaaaagtgattgggtgtgttcct
catgatcttggtgatccagacgatgagccatttgtacgtgtaaatgcatattgcattcat
gacacttcgcaatggaaagacttaaaccttcattttgtgctgcaggtctaccgagatttt
tatattacaaaaaataaacagtttttaatggacatgtggccagcaatgaaggctgccatg
gctcattcgcttgcccaagacattgatggtgatggtattattgaaaattctggaatagca
gatagtacatttgacacttgggttgttactggcccgagtgcatacactgggggattgtgg
ttaagcgctttgcgatgtatcattgaaattgctcatattttgggactatcacaaagtatt
tctaaatataaaagcatccttgaacgaggaaaaaagtcttacgaaaaaaagttatggaat
ggtacatattacaattatgatggaagtgaaaatgattaccataattgtatcatggcagga
caatgtgctggacaatggtacttacatgcttgtgatcttggacaaacagaggatgatctg
gtatttcgtcctgagcaagttcatagtacactgaaagtcatctttcaaaacaacgtaatg
cgtttcgaggatggttttatgggtgctgtaaacggaatgcgcgctgacggaacggttgac
aaaaacagtctccaagcagaggaagtttggacgggggtaacatatgctttagctgcaaca
atgattcagcacggtatggtgcgagaaggttttcgtaccgctgaaggaatatacagaaca
gtatatgaaaagtggggactgggttttcaaacccctgaagctattactgctaacaaaaca
tttcgaagccgtggctacatgaggccactaagcatctggagtatctatcatgcatatagc
aaaagagtaaactctcataagggtgaatcgtaa

DBGET integrated database retrieval system