KEGG   Hydra vulgaris: 100205307Help
Entry
100205307         CDS       T01080                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100205307
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 242 aa AA seqDB search
MNIWVKYFTFSLLFTRKMAWRSHGKDNNDLVYTLKKNGILTSPRVEKAMLKVDRGHFSRQ
NPYFDAPQSIGYSVTISAPHMHVHALQHLENHLTEGSVALDVGSGSGYLTACMAYMVGNT
GKVYGIDHIGELVEQSEINIMKGNKELITNGVVKLITGDGRLGYQEGGPYDAIHVGAAAP
ELPLPLLNQLKIGGRLIIPVGPEGGNQILLQCDKLSDGSIKETKLMGVIYVPLTDKFHQL
KS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttgggtgaaatattttacattttcattacttttcacaaggaaaatggcctgg
cgatctcatggaaaagacaataatgatttagtttacacactgaaaaaaaatggtattctt
acatcgccaagagtagaaaaagctatgctgaaggtggatcgaggtcatttcagtagacaa
aatccatattttgatgcgcctcaaagcataggttattcagttacaatcagtgctcctcat
atgcatgtacatgctttgcaacatctggaaaatcatcttacagaaggtagtgttgccctt
gatgttggttcaggaagtggttatcttactgcatgtatggcttatatggtaggaaatact
ggaaaagtatatggaattgatcatattggtgagcttgtggaacaatccgagatcaacatt
atgaaaggaaacaaagaacttattacaaatggtgttgttaagctaattactggagatggt
cggcttggttatcaagaaggtggaccttatgatgcaatacatgttggtgctgctgctcca
gaacttcctctaccactgttaaatcaactaaagattggtggtcggcttattatacccgta
ggacctgagggaggcaatcaaattcttttgcagtgtgacaaactatctgatggtagtatt
aaggaaacaaaactgatgggtgttatctatgttccattgacagacaagtttcatcagttg
aaatcatag

DBGET integrated database retrieval system